Csa1G132710 (gene) Cucumber (Chinese Long) v2
The following sequences are available for this feature:
Legend: CDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATTCAGTACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGTCTGAGATTTCTCTTCGATGGTTTTTTTCATCGACATGGTTTGATTCTCATGGGGTTTGTTTTTTTTTTTCTTTTTTTCTTTTTTGTTGATGTTTGTTGTAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAGTAAGTATTTCATGATTCTTCTCTATAATCATTATTTCTTGGGTCGAATCCTGTTTTGATAGTCGGAAACGAACTAAATTGGAAGTGGAAGAGATTTCTCTCACAATCATCGGCTGCTTTCAATGTGATTGTGCGATATAATCTGAATACATTTGAGATCTGTGTAGTTTGATTATGCAATAGATTGATTGCGTGATGATTAATCTGAATACATTTGAGATCTTTGTAGTTGGATTATGCAATAGATTGATTGCGTGATGATTAATCTGAAGTAAATATATCATAATTTCTTGTGTGAAATCCTGTTCCGCTAATTGAAAAGAAAATGAACTAAAAAATTGAAAGAGATCTCTCTCATAATCTGAATACCTTTAAGATGAAGTAATGGAATTTGATGTTGATGATGAACAGAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAAATTGGTTTATTGTCCTTTTTTTTCCTTTAGACACACTATAATGAGAAATATCTCACTACAAAACAAAAAAAAATTAAGTGTTTGTGGTTTGTTGTGTGGTGTAGTTTCCTTCTCCAATTTGGAGAAGCTTTGTGGCCCAGTTAGATCTTTGTCATAGTCATTAATCAATTCCCCACCATTGTTCATGAATTTGTGGTTTTAATTTGCTTTTGATATAAGCGTGGTTCTTATCTTCTCTTCTTCTTGGCTGCC ATGGGTCAGATTCAGTACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAA ATGGGTCAGATTCAGTACTCTGAGAAGTACTTTGATGATATCTATGAGTATAGGCATGTGGTGCTTACTCCTGAAGTGGCGAAACTTCTCCCCAAGAATCGCCTTCTTTCTGAAAATGAATGGAGAGCGATCGGTGTTCAACAAAGCCGTGGATGGGTTCATTATGCAATTCATCGCCCAGAGCCACACATAATGTTGTTCAGAAGGCCACTCAACTATCAACAGCAGCAAGAGAATCAAGCACAACAGCAGATTTTGGCCAAGTAA MGQIQYSEKYFDDIYEYRHVVLTPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENQAQQQILAK*
BLAST of Csa1G132710 vs. Swiss-Prot
Match: CKS1_ARATH (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana GN=CKS1 PE=1 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 9.9e-42 Identity = 78/86 (90.70%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Csa1G132710 vs. Swiss-Prot
Match: CKS1_ORYSI (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica GN=CKS1 PE=2 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 2.7e-39 Identity = 76/81 (93.83%), Postives = 75/81 (92.59%), Query Frame = 1
BLAST of Csa1G132710 vs. Swiss-Prot
Match: CKS1_ORYSJ (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica GN=CKS1 PE=2 SV=1) HSP 1 Score: 162.2 bits (409), Expect = 2.7e-39 Identity = 76/81 (93.83%), Postives = 75/81 (92.59%), Query Frame = 1
BLAST of Csa1G132710 vs. Swiss-Prot
Match: CKS2_ARATH (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana GN=CKS2 PE=3 SV=1) HSP 1 Score: 154.8 bits (390), Expect = 4.3e-37 Identity = 70/80 (87.50%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of Csa1G132710 vs. Swiss-Prot
Match: CKS1_PHYPO (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum PE=1 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.0e-27 Identity = 52/66 (78.79%), Postives = 59/66 (89.39%), Query Frame = 1
BLAST of Csa1G132710 vs. TrEMBL
Match: A0A0A0LY04_CUCSA (Cyclin-dependent kinases regulatory subunit OS=Cucumis sativus GN=Csa_1G132710 PE=3 SV=1) HSP 1 Score: 185.7 bits (470), Expect = 2.5e-44 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa1G132710 vs. TrEMBL
Match: B9SCL8_RICCO (Cyclin-dependent kinases regulatory subunit OS=Ricinus communis GN=RCOM_0475440 PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 4.0e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. TrEMBL
Match: A0A0D2UD86_GOSRA (Cyclin-dependent kinases regulatory subunit OS=Gossypium raimondii GN=B456_009G089700 PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 4.0e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. TrEMBL
Match: A0A061GWB0_THECC (Cyclin-dependent kinases regulatory subunit OS=Theobroma cacao GN=TCM_041571 PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 5.3e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. TrEMBL
Match: A0A0B0ML77_GOSAR (Cyclin-dependent kinases regulatory subunit OS=Gossypium arboreum GN=F383_01496 PE=3 SV=1) HSP 1 Score: 177.2 bits (448), Expect = 9.0e-42 Identity = 83/88 (94.32%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. TAIR10
Match: AT2G27960.1 (AT2G27960.1 cyclin-dependent kinase-subunit 1) HSP 1 Score: 170.2 bits (430), Expect = 5.6e-43 Identity = 78/86 (90.70%), Postives = 80/86 (93.02%), Query Frame = 1
BLAST of Csa1G132710 vs. TAIR10
Match: AT2G27970.1 (AT2G27970.1 CDK-subunit 2) HSP 1 Score: 154.8 bits (390), Expect = 2.4e-38 Identity = 70/80 (87.50%), Postives = 74/80 (92.50%), Query Frame = 1
BLAST of Csa1G132710 vs. NCBI nr
Match: gi|659071885|ref|XP_008462400.1| (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Cucumis melo]) HSP 1 Score: 185.7 bits (470), Expect = 3.6e-44 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
BLAST of Csa1G132710 vs. NCBI nr
Match: gi|720036280|ref|XP_010267302.1| (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Nelumbo nucifera]) HSP 1 Score: 180.3 bits (456), Expect = 1.5e-42 Identity = 85/88 (96.59%), Postives = 86/88 (97.73%), Query Frame = 1
BLAST of Csa1G132710 vs. NCBI nr
Match: gi|255565493|ref|XP_002523737.1| (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Ricinus communis]) HSP 1 Score: 178.3 bits (451), Expect = 5.8e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. NCBI nr
Match: gi|823223912|ref|XP_012444712.1| (PREDICTED: cyclin-dependent kinases regulatory subunit 1 [Gossypium raimondii]) HSP 1 Score: 178.3 bits (451), Expect = 5.8e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
BLAST of Csa1G132710 vs. NCBI nr
Match: gi|590587770|ref|XP_007016049.1| (Cyclin-dependent kinases regulatory subunit 1 [Theobroma cacao]) HSP 1 Score: 177.9 bits (450), Expect = 7.6e-42 Identity = 84/88 (95.45%), Postives = 85/88 (96.59%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of cucumber (Chinese Long)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|