Cp4.1LG01g22210 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATAGCTCGCAACAGATGAGCTTTCAGGCTGGAGAGGCGAAGGGCCAAGCTAAGGAGAAGACAAGCAATTTGATTGAGAAAGCTAGCAATGCAGCTCAATCAGCGAAAGAGACCGTGCAAGAGGCAGGCCAACAGATGGTGGCTAAGGCTCAAGGAGCCGCCGAGGCTGTGAAGGATGCCACCGGATTGAACAAATGA ATGGCGGATAGCTCGCAACAGATGAGCTTTCAGGCTGGAGAGGCGAAGGGCCAAGCTAAGGAGAAGACAAGCAATTTGATTGAGAAAGCTAGCAATGCAGCTCAATCAGCGAAAGAGACCGTGCAAGAGGCAGGCCAACAGATGGTGGCTAAGGCTCAAGGAGCCGCCGAGGCTGTGAAGGATGCCACCGGATTGAACAAATGA ATGGCGGATAGCTCGCAACAGATGAGCTTTCAGGCTGGAGAGGCGAAGGGCCAAGCTAAGGAGAAGACAAGCAATTTGATTGAGAAAGCTAGCAATGCAGCTCAATCAGCGAAAGAGACCGTGCAAGAGGCAGGCCAACAGATGGTGGCTAAGGCTCAAGGAGCCGCCGAGGCTGTGAAGGATGCCACCGGATTGAACAAATGA MADSSQQMSFQAGEAKGQAKEKTSNLIEKASNAAQSAKETVQEAGQQMVAKAQGAAEAVKDATGLNK
BLAST of Cp4.1LG01g22210 vs. TrEMBL
Match: A0A0A0KVV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643260 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 3.1e-18 Identity = 53/67 (79.10%), Postives = 64/67 (95.52%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TrEMBL
Match: A0A0A0KPD4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165870 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 4.4e-17 Identity = 52/67 (77.61%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TrEMBL
Match: W9RDZ1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_009672 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 2.2e-16 Identity = 51/67 (76.12%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TrEMBL
Match: A0A0A0KRE1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165860 PE=4 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.9e-15 Identity = 49/67 (73.13%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TrEMBL
Match: B9H3T9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s10750g PE=4 SV=2) HSP 1 Score: 87.8 bits (216), Expect = 5.4e-15 Identity = 48/67 (71.64%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TAIR10
Match: AT5G53820.1 (AT5G53820.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 82.4 bits (202), Expect = 1.2e-16 Identity = 44/67 (65.67%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TAIR10
Match: AT5G38760.1 (AT5G38760.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 79.3 bits (194), Expect = 9.7e-16 Identity = 43/67 (64.18%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TAIR10
Match: AT3G02480.1 (AT3G02480.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 67.0 bits (162), Expect = 5.0e-12 Identity = 36/65 (55.38%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. TAIR10
Match: AT5G15970.1 (AT5G15970.1 stress-responsive protein (KIN2) / stress-induced protein (KIN2) / cold-responsive protein (COR6.6) / cold-regulated protein (COR6.6)) HSP 1 Score: 47.0 bits (110), Expect = 5.4e-06 Identity = 28/59 (47.46%), Postives = 42/59 (71.19%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. NCBI nr
Match: gi|659119050|ref|XP_008459448.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 103.6 bits (257), Expect = 1.4e-19 Identity = 56/67 (83.58%), Postives = 66/67 (98.51%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. NCBI nr
Match: gi|449447460|ref|XP_004141486.1| (PREDICTED: late embryogenesis abundant protein 2-like [Cucumis sativus]) HSP 1 Score: 98.6 bits (244), Expect = 4.4e-18 Identity = 53/67 (79.10%), Postives = 64/67 (95.52%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. NCBI nr
Match: gi|449469355|ref|XP_004152386.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis sativus]) HSP 1 Score: 94.7 bits (234), Expect = 6.4e-17 Identity = 52/67 (77.61%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. NCBI nr
Match: gi|703115476|ref|XP_010100902.1| (hypothetical protein L484_009672 [Morus notabilis]) HSP 1 Score: 92.4 bits (228), Expect = 3.2e-16 Identity = 51/67 (76.12%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cp4.1LG01g22210 vs. NCBI nr
Match: gi|658013078|ref|XP_008341834.1| (PREDICTED: stress-induced protein KIN2-like [Malus domestica]) HSP 1 Score: 91.7 bits (226), Expect = 5.4e-16 Identity = 50/67 (74.63%), Postives = 63/67 (94.03%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|