Cucsa.238340 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGATAGTTCCCAAAAGATGAGCTACCAAGCTGGAGAAGCCAAAGGTCAGGTGGAAGAGAAGGCGAGCAATCTCATGGACAACGCAAACAATGCAGCTCAATCGGCTAAAGAGACGATACAGGAGGCAGGCCAACAGGTGATGGCAAAGGCTCAAGGAGCAGCCGAAGCTATCAAGGATGCAACTGGCATGAACAAATAA ATGGCGGATAGTTCCCAAAAGATGAGCTACCAAGCTGGAGAAGCCAAAGGTCAGGTGGAAGAGAAGGCGAGCAATCTCATGGACAACGCAAACAATGCAGCTCAATCGGCTAAAGAGACGATACAGGAGGCAGGCCAACAGGTGATGGCAAAGGCTCAAGGAGCAGCCGAAGCTATCAAGGATGCAACTGGCATGAACAAATAA ATGGCGGATAGTTCCCAAAAGATGAGCTACCAAGCTGGAGAAGCCAAAGGTCAGGTGGAAGAGAAGGCGAGCAATCTCATGGACAACGCAAACAATGCAGCTCAATCGGCTAAAGAGACGATACAGGAGGCAGGCCAACAGGTGATGGCAAAGGCTCAAGGAGCAGCCGAAGCTATCAAGGATGCAACTGGCATGAACAAATAA MADSSQKMSYQAGEAKGQVEEKASNLMDNANNAAQSAKETIQEAGQQVMAKAQGAAEAIKDATGMNK*
BLAST of Cucsa.238340 vs. Swiss-Prot
Match: KIN2_ARATH (Stress-induced protein KIN2 OS=Arabidopsis thaliana GN=KIN2 PE=2 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.2e-07 Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Cucsa.238340 vs. Swiss-Prot
Match: KIN1_ARATH (Stress-induced protein KIN1 OS=Arabidopsis thaliana GN=KIN1 PE=2 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.0e-07 Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Cucsa.238340 vs. Swiss-Prot
Match: LEA2_CICAR (Late embryogenesis abundant protein 2 OS=Cicer arietinum PE=2 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.0e-06 Identity = 26/60 (43.33%), Postives = 37/60 (61.67%), Query Frame = 1
HSP 2 Score: 46.6 bits (109), Expect = 1.3e-04 Identity = 26/71 (36.62%), Postives = 37/71 (52.11%), Query Frame = 1
HSP 3 Score: 40.0 bits (92), Expect = 1.2e-02 Identity = 20/66 (30.30%), Postives = 35/66 (53.03%), Query Frame = 1
HSP 4 Score: 40.0 bits (92), Expect = 1.2e-02 Identity = 28/90 (31.11%), Postives = 38/90 (42.22%), Query Frame = 1
BLAST of Cucsa.238340 vs. TrEMBL
Match: A0A0A0KVV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643260 PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.3e-27 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Cucsa.238340 vs. TrEMBL
Match: B9H3T9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0004s10750g PE=4 SV=2) HSP 1 Score: 107.8 bits (268), Expect = 5.1e-21 Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cucsa.238340 vs. TrEMBL
Match: B9H3U3_POPTR (ABA-inducible family protein OS=Populus trichocarpa GN=POPTR_0004s10690g PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 6.7e-21 Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cucsa.238340 vs. TrEMBL
Match: B9H3U1_POPTR (ABA-inducible family protein OS=Populus trichocarpa GN=POPTR_0004s10710g PE=4 SV=1) HSP 1 Score: 107.5 bits (267), Expect = 6.7e-21 Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cucsa.238340 vs. TrEMBL
Match: U5FJW3_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0017s14320g PE=4 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 1.1e-20 Identity = 52/67 (77.61%), Postives = 61/67 (91.04%), Query Frame = 1
BLAST of Cucsa.238340 vs. TAIR10
Match: AT5G38760.1 (AT5G38760.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 94.0 bits (232), Expect = 3.9e-20 Identity = 43/67 (64.18%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cucsa.238340 vs. TAIR10
Match: AT5G53820.1 (AT5G53820.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 92.4 bits (228), Expect = 1.1e-19 Identity = 44/67 (65.67%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Cucsa.238340 vs. TAIR10
Match: AT3G02480.1 (AT3G02480.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 81.3 bits (199), Expect = 2.6e-16 Identity = 37/65 (56.92%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of Cucsa.238340 vs. TAIR10
Match: AT5G15970.1 (AT5G15970.1 stress-responsive protein (KIN2) / stress-induced protein (KIN2) / cold-responsive protein (COR6.6) / cold-regulated protein (COR6.6)) HSP 1 Score: 56.6 bits (135), Expect = 6.9e-09 Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
BLAST of Cucsa.238340 vs. TAIR10
Match: AT5G15960.1 (AT5G15960.1 stress-responsive protein (KIN1) / stress-induced protein (KIN1)) HSP 1 Score: 54.3 bits (129), Expect = 3.4e-08 Identity = 26/63 (41.27%), Postives = 39/63 (61.90%), Query Frame = 1
BLAST of Cucsa.238340 vs. NCBI nr
Match: gi|449447460|ref|XP_004141486.1| (PREDICTED: late embryogenesis abundant protein 2-like [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 1.8e-27 Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 1
BLAST of Cucsa.238340 vs. NCBI nr
Match: gi|659119050|ref|XP_008459448.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 62/67 (92.54%), Postives = 65/67 (97.01%), Query Frame = 1
BLAST of Cucsa.238340 vs. NCBI nr
Match: gi|658013078|ref|XP_008341834.1| (PREDICTED: stress-induced protein KIN2-like [Malus domestica]) HSP 1 Score: 109.8 bits (273), Expect = 1.9e-21 Identity = 53/67 (79.10%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Cucsa.238340 vs. NCBI nr
Match: gi|566165971|ref|XP_002305297.2| (hypothetical protein POPTR_0004s10750g [Populus trichocarpa]) HSP 1 Score: 107.8 bits (268), Expect = 7.4e-21 Identity = 52/67 (77.61%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Cucsa.238340 vs. NCBI nr
Match: gi|658013080|ref|XP_008341835.1| (PREDICTED: late embryogenesis abundant protein 2-like [Malus domestica]) HSP 1 Score: 107.8 bits (268), Expect = 7.4e-21 Identity = 52/67 (77.61%), Postives = 61/67 (91.04%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|