Lsi03G002060 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCGATAGTTCTCAAAAGATGAGCTACCATGCCGGAGAAGTCAAAGGTCAGGTTGAAGAGAAGGCGAGTAATCTAATAGAGAAGGCAAGCAATGCAGCTCAATCGGTGAAAGAGACAGTGCAAGAGACAGGCCAACAGATGATGGCGAAGGCTCAAGGAGCAGCAGAGGCTATCAAGGATGCCACCGGCCTCAACAAATGA ATGGCCGATAGTTCTCAAAAGATGAGCTACCATGCCGGAGAAGTCAAAGGTCAGGTTGAAGAGAAGGCGAGTAATCTAATAGAGAAGGCAAGCAATGCAGCTCAATCGGTGAAAGAGACAGTGCAAGAGACAGGCCAACAGATGATGGCGAAGGCTCAAGGAGCAGCAGAGGCTATCAAGGATGCCACCGGCCTCAACAAATGA ATGGCCGATAGTTCTCAAAAGATGAGCTACCATGCCGGAGAAGTCAAAGGTCAGGTTGAAGAGAAGGCGAGTAATCTAATAGAGAAGGCAAGCAATGCAGCTCAATCGGTGAAAGAGACAGTGCAAGAGACAGGCCAACAGATGATGGCGAAGGCTCAAGGAGCAGCAGAGGCTATCAAGGATGCCACCGGCCTCAACAAATGA MADSSQKMSYHAGEVKGQVEEKASNLIEKASNAAQSVKETVQETGQQMMAKAQGAAEAIKDATGLNK
BLAST of Lsi03G002060 vs. TrEMBL
Match: A0A0A0KVV6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643260 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-20 Identity = 56/67 (83.58%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Lsi03G002060 vs. TrEMBL
Match: W9RDZ1_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_009672 PE=4 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 4.0e-18 Identity = 50/67 (74.63%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Lsi03G002060 vs. TrEMBL
Match: A0A0A0KRE1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165860 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 2.6e-17 Identity = 48/67 (71.64%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Lsi03G002060 vs. TrEMBL
Match: A0A0A0KPD4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G165870 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.4e-17 Identity = 49/67 (73.13%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Lsi03G002060 vs. TrEMBL
Match: A0A0A0KXN2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G643250 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.4e-17 Identity = 49/62 (79.03%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of Lsi03G002060 vs. TAIR10
Match: AT5G53820.1 (AT5G53820.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 84.7 bits (208), Expect = 2.3e-17 Identity = 43/67 (64.18%), Postives = 58/67 (86.57%), Query Frame = 1
BLAST of Lsi03G002060 vs. TAIR10
Match: AT5G38760.1 (AT5G38760.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 81.3 bits (199), Expect = 2.6e-16 Identity = 40/67 (59.70%), Postives = 57/67 (85.07%), Query Frame = 1
BLAST of Lsi03G002060 vs. TAIR10
Match: AT3G02480.1 (AT3G02480.1 Late embryogenesis abundant protein (LEA) family protein) HSP 1 Score: 69.3 bits (168), Expect = 1.0e-12 Identity = 34/65 (52.31%), Postives = 49/65 (75.38%), Query Frame = 1
BLAST of Lsi03G002060 vs. NCBI nr
Match: gi|659119050|ref|XP_008459448.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 107.8 bits (268), Expect = 7.3e-21 Identity = 57/67 (85.07%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Lsi03G002060 vs. NCBI nr
Match: gi|449447460|ref|XP_004141486.1| (PREDICTED: late embryogenesis abundant protein 2-like [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 2.8e-20 Identity = 56/67 (83.58%), Postives = 62/67 (92.54%), Query Frame = 1
BLAST of Lsi03G002060 vs. NCBI nr
Match: gi|703115476|ref|XP_010100902.1| (hypothetical protein L484_009672 [Morus notabilis]) HSP 1 Score: 98.2 bits (243), Expect = 5.7e-18 Identity = 50/67 (74.63%), Postives = 59/67 (88.06%), Query Frame = 1
BLAST of Lsi03G002060 vs. NCBI nr
Match: gi|659073373|ref|XP_008437025.1| (PREDICTED: stress-induced protein KIN2-like [Cucumis melo]) HSP 1 Score: 97.8 bits (242), Expect = 7.5e-18 Identity = 49/67 (73.13%), Postives = 60/67 (89.55%), Query Frame = 1
BLAST of Lsi03G002060 vs. NCBI nr
Match: gi|1009127017|ref|XP_015880470.1| (PREDICTED: stress-induced protein KIN2-like [Ziziphus jujuba]) HSP 1 Score: 96.7 bits (239), Expect = 1.7e-17 Identity = 49/65 (75.38%), Postives = 59/65 (90.77%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |