CmaCh19G006370 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTACGACGACGTGGAGATTGAAGACATGGAGTGGAATGAGGAACTGCAGGCCTTCACGTACCCATGCCCTTGCGGCGACTTGTTCCAGATTACGAAGGAGGATCTTAAGCTCGGTGAAGAGATTGCTCGGTGCCCTAGCTGTTCTCTTTACATCACAGTTATCTACAACATGGAAGATTTTCTCGGAGACTCTGATCACAAGAATAACAAAGGACTTCAGCCCTCCAAGCAACAGCCTATCGTTGTCGCTTGA ATGTCGTACGACGACGTGGAGATTGAAGACATGGAGTGGAATGAGGAACTGCAGGCCTTCACGTACCCATGCCCTTGCGGCGACTTGTTCCAGATTACGAAGGAGGATCTTAAGCTCGGTGAAGAGATTGCTCGGTGCCCTAGCTGTTCTCTTTACATCACAGTTATCTACAACATGGAAGATTTTCTCGGAGACTCTGATCACAAGAATAACAAAGGACTTCAGCCCTCCAAGCAACAGCCTATCGTTGTCGCTTGA ATGTCGTACGACGACGTGGAGATTGAAGACATGGAGTGGAATGAGGAACTGCAGGCCTTCACGTACCCATGCCCTTGCGGCGACTTGTTCCAGATTACGAAGGAGGATCTTAAGCTCGGTGAAGAGATTGCTCGGTGCCCTAGCTGTTCTCTTTACATCACAGTTATCTACAACATGGAAGATTTTCTCGGAGACTCTGATCACAAGAATAACAAAGGACTTCAGCCCTCCAAGCAACAGCCTATCGTTGTCGCTTGA MSYDDVEIEDMEWNEELQAFTYPCPCGDLFQITKEDLKLGEEIARCPSCSLYITVIYNMEDFLGDSDHKNNKGLQPSKQQPIVVA
BLAST of CmaCh19G006370 vs. Swiss-Prot
Match: DPH3_DROME (DPH3 homolog OS=Drosophila melanogaster GN=CG14701 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.6e-18 Identity = 39/68 (57.35%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of CmaCh19G006370 vs. Swiss-Prot
Match: DPH3_CAEEL (DPH3 homolog OS=Caenorhabditis elegans GN=K01H12.1 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.6e-17 Identity = 36/61 (59.02%), Postives = 50/61 (81.97%), Query Frame = 1
BLAST of CmaCh19G006370 vs. Swiss-Prot
Match: DPH3_CRIGR (DPH3 homolog OS=Cricetulus griseus GN=DPH3 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.8e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of CmaCh19G006370 vs. Swiss-Prot
Match: DPH3_PONAB (DPH3 homolog OS=Pongo abelii GN=DPH3 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.6e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of CmaCh19G006370 vs. Swiss-Prot
Match: DPH3_MOUSE (DPH3 homolog OS=Mus musculus GN=Dph3 PE=1 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.6e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TrEMBL
Match: A0A0A0K4W9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G075060 PE=4 SV=1) HSP 1 Score: 172.2 bits (435), Expect = 2.8e-40 Identity = 78/85 (91.76%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TrEMBL
Match: I3SPP6_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 3.1e-39 Identity = 77/86 (89.53%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TrEMBL
Match: A0A0B2PEW4_GLYSO (DPH3 like OS=Glycine soja GN=glysoja_031610 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 4.0e-39 Identity = 77/86 (89.53%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TrEMBL
Match: K7LPC5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G123600 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 4.0e-39 Identity = 77/86 (89.53%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TrEMBL
Match: A0A0B2R0A8_GLYSO (DPH3 like OS=Glycine soja GN=glysoja_010249 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 1.2e-38 Identity = 76/86 (88.37%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of CmaCh19G006370 vs. TAIR10
Match: AT2G15910.1 (AT2G15910.1 CSL zinc finger domain-containing protein) HSP 1 Score: 139.8 bits (351), Expect = 7.7e-34 Identity = 64/82 (78.05%), Postives = 71/82 (86.59%), Query Frame = 1
BLAST of CmaCh19G006370 vs. NCBI nr
Match: gi|659109803|ref|XP_008454889.1| (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo]) HSP 1 Score: 174.9 bits (442), Expect = 6.1e-41 Identity = 79/85 (92.94%), Postives = 82/85 (96.47%), Query Frame = 1
BLAST of CmaCh19G006370 vs. NCBI nr
Match: gi|449438452|ref|XP_004137002.1| (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis sativus]) HSP 1 Score: 172.2 bits (435), Expect = 4.0e-40 Identity = 78/85 (91.76%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of CmaCh19G006370 vs. NCBI nr
Match: gi|388508344|gb|AFK42238.1| (unknown [Lotus japonicus]) HSP 1 Score: 168.7 bits (426), Expect = 4.4e-39 Identity = 77/86 (89.53%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of CmaCh19G006370 vs. NCBI nr
Match: gi|571488375|ref|XP_003537913.2| (PREDICTED: diphthamide biosynthesis protein 3 [Glycine max]) HSP 1 Score: 168.3 bits (425), Expect = 5.7e-39 Identity = 77/86 (89.53%), Postives = 82/86 (95.35%), Query Frame = 1
BLAST of CmaCh19G006370 vs. NCBI nr
Match: gi|1009168474|ref|XP_015902678.1| (PREDICTED: diphthamide biosynthesis protein 3-like [Ziziphus jujuba]) HSP 1 Score: 167.2 bits (422), Expect = 1.3e-38 Identity = 74/85 (87.06%), Postives = 79/85 (92.94%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |