Cla97C02G032500 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA MSYDDVEIEDMEWNEELQAFTYPCPCGDLFQITKEDLKLGEEIARCPSCSLYITVIYNMEDFLGDSNQKNNKGIEPPKQQPIVVA
BLAST of Cla97C02G032500 vs. NCBI nr
Match: XP_022972367.1 (diphthamide biosynthesis protein 3-like [Cucurbita maxima]) HSP 1 Score: 177.2 bits (448), Expect = 2.4e-41 Identity = 80/85 (94.12%), Postives = 83/85 (97.65%), Query Frame = 0
BLAST of Cla97C02G032500 vs. NCBI nr
Match: XP_008454889.1 (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo] >XP_008454890.1 PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo]) HSP 1 Score: 176.4 bits (446), Expect = 4.1e-41 Identity = 80/85 (94.12%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of Cla97C02G032500 vs. NCBI nr
Match: XP_022136247.1 (diphthamide biosynthesis protein 3-like [Momordica charantia]) HSP 1 Score: 176.4 bits (446), Expect = 4.1e-41 Identity = 79/85 (92.94%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of Cla97C02G032500 vs. NCBI nr
Match: XP_004137002.1 (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis sativus] >KGN43974.1 hypothetical protein Csa_7G075060 [Cucumis sativus]) HSP 1 Score: 173.7 bits (439), Expect = 2.7e-40 Identity = 79/85 (92.94%), Postives = 81/85 (95.29%), Query Frame = 0
BLAST of Cla97C02G032500 vs. NCBI nr
Match: XP_022931585.1 (diphthamide biosynthesis protein 3-like [Cucurbita moschata]) HSP 1 Score: 172.9 bits (437), Expect = 4.5e-40 Identity = 79/85 (92.94%), Postives = 81/85 (95.29%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TrEMBL
Match: tr|A0A1S3BZL5|A0A1S3BZL5_CUCME (diphthamide biosynthesis protein 3-like OS=Cucumis melo OX=3656 GN=LOC103495198 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 2.7e-41 Identity = 80/85 (94.12%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TrEMBL
Match: tr|A0A0A0K4W9|A0A0A0K4W9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G075060 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.8e-40 Identity = 79/85 (92.94%), Postives = 81/85 (95.29%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TrEMBL
Match: tr|A0A200QTM0|A0A200QTM0_9MAGN (Zinc finger protein OS=Macleaya cordata OX=56857 GN=BVC80_1769g68 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 6.2e-38 Identity = 72/85 (84.71%), Postives = 80/85 (94.12%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TrEMBL
Match: tr|B9RZF9|B9RZF9_RICCO (Diphthamide biosynthesis protein, putative OS=Ricinus communis OX=3988 GN=RCOM_0939000 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 1.1e-37 Identity = 75/85 (88.24%), Postives = 78/85 (91.76%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TrEMBL
Match: tr|A0A2I4HGW5|A0A2I4HGW5_9ROSI (diphthamide biosynthesis protein 3-like OS=Juglans regia OX=51240 GN=LOC109017527 PE=4 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 1.4e-37 Identity = 72/85 (84.71%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of Cla97C02G032500 vs. Swiss-Prot
Match: sp|Q21102|DPH3_CAEEL (DPH3 homolog OS=Caenorhabditis elegans OX=6239 GN=K01H12.1 PE=3 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 5.7e-18 Identity = 39/75 (52.00%), Postives = 54/75 (72.00%), Query Frame = 0
BLAST of Cla97C02G032500 vs. Swiss-Prot
Match: sp|Q74Z32|DPH3_ASHGO (Diphthamide biosynthesis protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DPH3 PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.3e-17 Identity = 40/75 (53.33%), Postives = 52/75 (69.33%), Query Frame = 0
BLAST of Cla97C02G032500 vs. Swiss-Prot
Match: sp|Q6CMG4|DPH3_KLULA (Diphthamide biosynthesis protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DPH3 PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.2e-17 Identity = 41/83 (49.40%), Postives = 58/83 (69.88%), Query Frame = 0
BLAST of Cla97C02G032500 vs. Swiss-Prot
Match: sp|Q3E840|DPH3_YEAST (Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTI11 PE=1 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.2e-17 Identity = 42/84 (50.00%), Postives = 55/84 (65.48%), Query Frame = 0
BLAST of Cla97C02G032500 vs. Swiss-Prot
Match: sp|Q6VUC1|DPH3_CRIGR (DPH3 homolog OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.8e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of Cla97C02G032500 vs. TAIR10
Match: AT2G15910.1 (CSL zinc finger domain-containing protein) HSP 1 Score: 141.0 bits (354), Expect = 3.5e-34 Identity = 65/82 (79.27%), Postives = 72/82 (87.80%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|