Cla015974 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA ATGTCGTACGACGACGTAGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACATACCCATGCCCCTGCGGCGACTTGTTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACGGTCATCTACAACATGGAAGATTTTCTTGGAGACTCTAATCAGAAGAATAACAAAGGAATTGAGCCCCCTAAACAACAGCCTATCGTGGTCGCTTAA MSYDDVEIEDMEWNEELQAFTYPCPCGDLFQITKEDLKLGEEIARCPSCSLYITVIYNMEDFLGDSNQKNNKGIEPPKQQPIVVA
BLAST of Cla015974 vs. Swiss-Prot
Match: DPH3_CAEEL (DPH3 homolog OS=Caenorhabditis elegans GN=K01H12.1 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 4.7e-17 Identity = 39/75 (52.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of Cla015974 vs. Swiss-Prot
Match: DPH3_ASHGO (Diphthamide biosynthesis protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH3 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 8.1e-17 Identity = 40/75 (53.33%), Postives = 50/75 (66.67%), Query Frame = 1
BLAST of Cla015974 vs. Swiss-Prot
Match: DPH3_DROME (DPH3 homolog OS=Drosophila melanogaster GN=CG14701 PE=3 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 1.1e-16 Identity = 38/68 (55.88%), Postives = 51/68 (75.00%), Query Frame = 1
BLAST of Cla015974 vs. Swiss-Prot
Match: DPH3_KLULA (Diphthamide biosynthesis protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH3 PE=3 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.8e-16 Identity = 41/83 (49.40%), Postives = 56/83 (67.47%), Query Frame = 1
BLAST of Cla015974 vs. Swiss-Prot
Match: DPH3_YEAST (Diphthamide biosynthesis protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTI11 PE=1 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.3e-16 Identity = 42/84 (50.00%), Postives = 53/84 (63.10%), Query Frame = 1
BLAST of Cla015974 vs. TrEMBL
Match: A0A0A0K4W9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G075060 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 1.1e-39 Identity = 79/85 (92.94%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of Cla015974 vs. TrEMBL
Match: B9RZF9_RICCO (Diphthamide biosynthesis protein, putative OS=Ricinus communis GN=RCOM_0939000 PE=4 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 6.4e-37 Identity = 75/85 (88.24%), Postives = 78/85 (91.76%), Query Frame = 1
BLAST of Cla015974 vs. TrEMBL
Match: I3SPP6_LOTJA (Uncharacterized protein OS=Lotus japonicus PE=2 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 8.3e-37 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cla015974 vs. TrEMBL
Match: A0A0B2PEW4_GLYSO (DPH3 like OS=Glycine soja GN=glysoja_031610 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.4e-36 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cla015974 vs. TrEMBL
Match: K7LPC5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_11G123600 PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.4e-36 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cla015974 vs. NCBI nr
Match: gi|659109803|ref|XP_008454889.1| (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo]) HSP 1 Score: 172.9 bits (437), Expect = 2.3e-40 Identity = 80/85 (94.12%), Postives = 82/85 (96.47%), Query Frame = 1
BLAST of Cla015974 vs. NCBI nr
Match: gi|449438452|ref|XP_004137002.1| (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis sativus]) HSP 1 Score: 170.2 bits (430), Expect = 1.5e-39 Identity = 79/85 (92.94%), Postives = 81/85 (95.29%), Query Frame = 1
BLAST of Cla015974 vs. NCBI nr
Match: gi|255556187|ref|XP_002519128.1| (PREDICTED: diphthamide biosynthesis protein 3 [Ricinus communis]) HSP 1 Score: 161.0 bits (406), Expect = 9.2e-37 Identity = 75/85 (88.24%), Postives = 78/85 (91.76%), Query Frame = 1
BLAST of Cla015974 vs. NCBI nr
Match: gi|388508344|gb|AFK42238.1| (unknown [Lotus japonicus]) HSP 1 Score: 160.6 bits (405), Expect = 1.2e-36 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 1
BLAST of Cla015974 vs. NCBI nr
Match: gi|571488375|ref|XP_003537913.2| (PREDICTED: diphthamide biosynthesis protein 3 [Glycine max]) HSP 1 Score: 159.8 bits (403), Expect = 2.0e-36 Identity = 74/86 (86.05%), Postives = 81/86 (94.19%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |