CmaCh18G008380 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCCCCGGTGACGGCGTCAGCGTCGGCGGCCTCTCGTCCCACCTGTTCTCTGACGGTAGCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCTGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTGGAAGAGGGAGAAGAGTTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCTAAGTTGCCGGAGGCAAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGTAAACATGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTTGCTCATCTCAAGGAGGATGAATTTGAATACGTTTAA ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCCCCGGTGACGGCGTCAGCGTCGGCGGCCTCTCGTCCCACCTGTTCTCTGACGGTAGCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCTGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTGGAAGAGGGAGAAGAGTTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCTAAGTTGCCGGAGGCAAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGTAAACATGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTTGCTCATCTCAAGGAGGATGAATTTGAATACGTTTAA ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCCCCGGTGACGGCGTCAGCGTCGGCGGCCTCTCGTCCCACCTGTTCTCTGACGGTAGCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCTGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTGGAAGAGGGAGAAGAGTTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCTAAGTTGCCGGAGGCAAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGTAAACATGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTTGCTCATCTCAAGGAGGATGAATTTGAATACGTTTAA MISIASSVGVIPSPVTASASAASRPTCSLTVATSVDVKSSYSSSVSSLSSVVANPFNCLIGRGRRVCSEVTVKSDSRGSSSATVVSAAATSLSEEETGEAAATRIGAKVRVKVPLKVYHVAKLPEANLEGMEGVLKDYVRVWKGKHVSANLPYKVEFVVPVEGRPPVKFVAHLKEDEFEYV
BLAST of CmaCh18G008380 vs. Swiss-Prot
Match: FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays PE=1 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 1.1e-23 Identity = 56/95 (58.95%), Postives = 74/95 (77.89%), Query Frame = 1
BLAST of CmaCh18G008380 vs. Swiss-Prot
Match: FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea GN=FTRV PE=1 SV=2) HSP 1 Score: 97.4 bits (241), Expect = 1.7e-19 Identity = 71/174 (40.80%), Postives = 99/174 (56.90%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TrEMBL
Match: A0A0A0KV36_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G580660 PE=4 SV=1) HSP 1 Score: 265.0 bits (676), Expect = 6.7e-68 Identity = 146/181 (80.66%), Postives = 161/181 (88.95%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TrEMBL
Match: A5B8T4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_10s0071g01160 PE=4 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 3.6e-29 Identity = 90/165 (54.55%), Postives = 113/165 (68.48%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TrEMBL
Match: W9RQM9_9ROSA (Ferredoxin-thioredoxin reductase, variable chain OS=Morus notabilis GN=L484_011027 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 4.7e-29 Identity = 88/176 (50.00%), Postives = 109/176 (61.93%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TrEMBL
Match: A8IXL0_BRACM (Lipoic acid synthase-like protein OS=Brassica campestris PE=2 SV=1) HSP 1 Score: 129.4 bits (324), Expect = 4.4e-27 Identity = 70/117 (59.83%), Postives = 86/117 (73.50%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TrEMBL
Match: R0FH45_9BRAS (Uncharacterized protein OS=Capsella rubella GN=CARUB_v10002077mg PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 1.7e-26 Identity = 78/184 (42.39%), Postives = 113/184 (61.41%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TAIR10
Match: AT5G08410.1 (AT5G08410.1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 2) HSP 1 Score: 121.3 bits (303), Expect = 6.0e-28 Identity = 79/172 (45.93%), Postives = 103/172 (59.88%), Query Frame = 1
BLAST of CmaCh18G008380 vs. TAIR10
Match: AT5G23440.1 (AT5G23440.1 ferredoxin/thioredoxin reductase subunit A (variable subunit) 1) HSP 1 Score: 114.8 bits (286), Expect = 5.7e-26 Identity = 72/181 (39.78%), Postives = 107/181 (59.12%), Query Frame = 1
BLAST of CmaCh18G008380 vs. NCBI nr
Match: gi|449458714|ref|XP_004147092.1| (PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cucumis sativus]) HSP 1 Score: 265.0 bits (676), Expect = 9.6e-68 Identity = 146/181 (80.66%), Postives = 161/181 (88.95%), Query Frame = 1
BLAST of CmaCh18G008380 vs. NCBI nr
Match: gi|659090253|ref|XP_008445916.1| (PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cucumis melo]) HSP 1 Score: 263.1 bits (671), Expect = 3.6e-67 Identity = 144/181 (79.56%), Postives = 161/181 (88.95%), Query Frame = 1
BLAST of CmaCh18G008380 vs. NCBI nr
Match: gi|225463817|ref|XP_002271306.1| (PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Vitis vinifera]) HSP 1 Score: 136.3 bits (342), Expect = 5.1e-29 Identity = 90/165 (54.55%), Postives = 113/165 (68.48%), Query Frame = 1
BLAST of CmaCh18G008380 vs. NCBI nr
Match: gi|703132722|ref|XP_010105193.1| (Ferredoxin-thioredoxin reductase, variable chain [Morus notabilis]) HSP 1 Score: 136.0 bits (341), Expect = 6.7e-29 Identity = 88/176 (50.00%), Postives = 109/176 (61.93%), Query Frame = 1
BLAST of CmaCh18G008380 vs. NCBI nr
Match: gi|720065061|ref|XP_010276155.1| (PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nelumbo nucifera]) HSP 1 Score: 134.8 bits (338), Expect = 1.5e-28 Identity = 74/129 (57.36%), Postives = 92/129 (71.32%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|