Carg14427 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCGCCGGTGACGGCGTCAGCGTCGGCGGCCGCTCGTCCCGCCTGTTCTATTACGACGGTGTCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCCGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTAGAAGAGGGAGGAGAATTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCGAAGTTGCCGGAGGCGAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGGAAACACGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTCGCTCATCTGAAGGAGGATGAATTTGAATACGTTTAA ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCGCCGGTGACGGCGTCAGCGTCGGCGGCCGCTCGTCCCGCCTGTTCTATTACGACGGTGTCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCCGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTAGAAGAGGGAGGAGAATTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCGAAGTTGCCGGAGGCGAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGGAAACACGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTCGCTCATCTGAAGGAGGATGAATTTGAATACGTTTAA ATGATCAGTATTGCAAGCAGTGTCGGCGTGATACCATCGCCGGTGACGGCGTCAGCGTCGGCGGCCGCTCGTCCCGCCTGTTCTATTACGACGGTGTCCACTAGTGTTGATGTCAAATCGTCCTATTCCTCGTCCGTTAGTTCTCTATCGTCAGTTGTTGCTAATCCTTTCAACTGCTTGATTAGAAGAGGGAGGAGAATTTGTAGCGAGGTTACAGTCAAATCAGATTCCAGAGGTTCCTCTTCTGCTACTGTTGTTTCGGCGGCGGCGACGTCATTGTCTGAGGAGGAGACTGGCGAAGCGGCTGCTACTAGAATTGGAGCGAAAGTTAGGGTTAAGGTACCTTTGAAGGTGTATCATGTAGCGAAGTTGCCGGAGGCGAATCTTGAGGGGATGGAAGGAGTGCTGAAGGACTATGTACGCGTTTGGAAGGGGAAACACGTTTCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCGGTTGAAGGCCGGCCTCCGGTCAAATTCGTCGCTCATCTGAAGGAGGATGAATTTGAATACGTTTAA MISIASSVGVIPSPVTASASAAARPACSITTVSTSVDVKSSYSSSVSSLSSVVANPFNCLIRRGRRICSEVTVKSDSRGSSSATVVSAAATSLSEEETGEAAATRIGAKVRVKVPLKVYHVAKLPEANLEGMEGVLKDYVRVWKGKHVSANLPYKVEFVVPVEGRPPVKFVAHLKEDEFEYV
BLAST of Carg14427 vs. NCBI nr
Match: XP_022945181.1 (ferredoxin-thioredoxin reductase, variable chain-like [Cucurbita moschata]) HSP 1 Score: 328.2 bits (840), Expect = 1.8e-86 Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 0
BLAST of Carg14427 vs. NCBI nr
Match: XP_023523040.1 (ferredoxin-thioredoxin reductase, variable chain-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 317.4 bits (812), Expect = 3.2e-83 Identity = 176/182 (96.70%), Postives = 179/182 (98.35%), Query Frame = 0
BLAST of Carg14427 vs. NCBI nr
Match: XP_022967006.1 (ferredoxin-thioredoxin reductase, variable chain-like [Cucurbita maxima]) HSP 1 Score: 314.3 bits (804), Expect = 2.7e-82 Identity = 173/182 (95.05%), Postives = 177/182 (97.25%), Query Frame = 0
BLAST of Carg14427 vs. NCBI nr
Match: XP_022999561.1 (ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 255.4 bits (651), Expect = 1.5e-64 Identity = 145/182 (79.67%), Postives = 156/182 (85.71%), Query Frame = 0
BLAST of Carg14427 vs. NCBI nr
Match: XP_023549490.1 (ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 226.5 bits (576), Expect = 7.4e-56 Identity = 134/182 (73.63%), Postives = 144/182 (79.12%), Query Frame = 0
BLAST of Carg14427 vs. TAIR10
Match: AT5G23440.1 (ferredoxin/thioredoxin reductase subunit A (variable subunit) 1) HSP 1 Score: 114.0 bits (284), Expect = 9.7e-26 Identity = 52/73 (71.23%), Postives = 61/73 (83.56%), Query Frame = 0
BLAST of Carg14427 vs. TAIR10
Match: AT5G08410.1 (ferredoxin/thioredoxin reductase subunit A (variable subunit) 2) HSP 1 Score: 101.7 bits (252), Expect = 5.0e-22 Identity = 45/67 (67.16%), Postives = 54/67 (80.60%), Query Frame = 0
BLAST of Carg14427 vs. Swiss-Prot
Match: sp|P80680|FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays OX=4577 PE=1 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 3.9e-24 Identity = 53/83 (63.86%), Postives = 68/83 (81.93%), Query Frame = 0
BLAST of Carg14427 vs. Swiss-Prot
Match: sp|P38365|FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea OX=3562 GN=FTRV PE=1 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 7.1e-18 Identity = 55/116 (47.41%), Postives = 69/116 (59.48%), Query Frame = 0
BLAST of Carg14427 vs. TrEMBL
Match: tr|A0A1S3BEI2|A0A1S3BEI2_CUCME (ferredoxin-thioredoxin reductase, variable chain OS=Cucumis melo OX=3656 GN=LOC103488798 PE=4 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 9.2e-55 Identity = 129/182 (70.88%), Postives = 143/182 (78.57%), Query Frame = 0
BLAST of Carg14427 vs. TrEMBL
Match: tr|A0A0A0KV36|A0A0A0KV36_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G580660 PE=4 SV=1) HSP 1 Score: 222.2 bits (565), Expect = 9.2e-55 Identity = 130/182 (71.43%), Postives = 143/182 (78.57%), Query Frame = 0
BLAST of Carg14427 vs. TrEMBL
Match: tr|A0A200QK40|A0A200QK40_9MAGN (Lipoyl synthase OS=Macleaya cordata OX=56857 GN=BVC80_645g82 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 5.1e-29 Identity = 82/164 (50.00%), Postives = 108/164 (65.85%), Query Frame = 0
BLAST of Carg14427 vs. TrEMBL
Match: tr|A0A2N9GEA3|A0A2N9GEA3_FAGSY (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS25581 PE=4 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 3.1e-26 Identity = 71/122 (58.20%), Postives = 84/122 (68.85%), Query Frame = 0
BLAST of Carg14427 vs. TrEMBL
Match: tr|A8IXL0|A8IXL0_BRACM (Lipoic acid synthase-like protein OS=Brassica campestris OX=3711 PE=2 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 4.0e-26 Identity = 81/165 (49.09%), Postives = 102/165 (61.82%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|