Carg02037 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCACTATGGCGAACAGTATCGGCGTGATACCAACGCCGGCGCCCACGGCCGCTCGTCCTGCCTGTTCTATGACGGTATTCTCTAGTACTGATTTCAAATCGTCCTATTCCCCGTCCGTGAGTTCTCTATCGTCAGTTGTTGTTAATCCTTTCAACTGCTCGGTTACAAGAGGGAGAAGATTCTTCAGCGAAGTTACTGTCAAATCAGATTCCGGTACTTTGTCTTCAGCTGCTGCTGTTTCGGCGGCGACGACGTCATTGTCGGAGGATGAGACGGATGAAGCGGCTGCCGCTAGAATTGGAGCCAGAGTTAGGGTTAAGGTGCCTTTGAAGGTGTATCATGTTGCTAAGTTACCGGAGGCGGATCTTGAGGGGATGGAAGGAGTGCTGAAGGATTATGTACGTGTTTGGAAGGGGAAGCGTGTATCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCAGTCGAAGGCCGTCCACCGGTCAAATTCCTAGCTCATCTTAAGGAGGAAGAATTTGAATACGTTTAA ATGATCACTATGGCGAACAGTATCGGCGTGATACCAACGCCGGCGCCCACGGCCGCTCGTCCTGCCTGTTCTATGACGGTATTCTCTAGTACTGATTTCAAATCGTCCTATTCCCCGTCCGTGAGTTCTCTATCGTCAGTTGTTGTTAATCCTTTCAACTGCTCGGTTACAAGAGGGAGAAGATTCTTCAGCGAAGTTACTGTCAAATCAGATTCCGGTACTTTGTCTTCAGCTGCTGCTGTTTCGGCGGCGACGACGTCATTGTCGGAGGATGAGACGGATGAAGCGGCTGCCGCTAGAATTGGAGCCAGAGTTAGGGTTAAGGTGCCTTTGAAGGTGTATCATGTTGCTAAGTTACCGGAGGCGGATCTTGAGGGGATGGAAGGAGTGCTGAAGGATTATGTACGTGTTTGGAAGGGGAAGCGTGTATCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCAGTCGAAGGCCGTCCACCGGTCAAATTCCTAGCTCATCTTAAGGAGGAAGAATTTGAATACGTTTAA ATGATCACTATGGCGAACAGTATCGGCGTGATACCAACGCCGGCGCCCACGGCCGCTCGTCCTGCCTGTTCTATGACGGTATTCTCTAGTACTGATTTCAAATCGTCCTATTCCCCGTCCGTGAGTTCTCTATCGTCAGTTGTTGTTAATCCTTTCAACTGCTCGGTTACAAGAGGGAGAAGATTCTTCAGCGAAGTTACTGTCAAATCAGATTCCGGTACTTTGTCTTCAGCTGCTGCTGTTTCGGCGGCGACGACGTCATTGTCGGAGGATGAGACGGATGAAGCGGCTGCCGCTAGAATTGGAGCCAGAGTTAGGGTTAAGGTGCCTTTGAAGGTGTATCATGTTGCTAAGTTACCGGAGGCGGATCTTGAGGGGATGGAAGGAGTGCTGAAGGATTATGTACGTGTTTGGAAGGGGAAGCGTGTATCTGCTAATCTTCCGTATAAGGTGGAGTTTGTTGTTCCAGTCGAAGGCCGTCCACCGGTCAAATTCCTAGCTCATCTTAAGGAGGAAGAATTTGAATACGTTTAA MITMANSIGVIPTPAPTAARPACSMTVFSSTDFKSSYSPSVSSLSSVVVNPFNCSVTRGRRFFSEVTVKSDSGTLSSAAAVSAATTSLSEDETDEAAAARIGARVRVKVPLKVYHVAKLPEADLEGMEGVLKDYVRVWKGKRVSANLPYKVEFVVPVEGRPPVKFLAHLKEEEFEYV
BLAST of Carg02037 vs. NCBI nr
Match: XP_022957590.1 (ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Cucurbita moschata]) HSP 1 Score: 295.8 bits (756), Expect = 9.6e-77 Identity = 175/177 (98.87%), Postives = 177/177 (100.00%), Query Frame = 0
BLAST of Carg02037 vs. NCBI nr
Match: XP_023549490.1 (ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 291.6 bits (745), Expect = 1.8e-75 Identity = 173/177 (97.74%), Postives = 175/177 (98.87%), Query Frame = 0
BLAST of Carg02037 vs. NCBI nr
Match: XP_022999561.1 (ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Cucurbita maxima]) HSP 1 Score: 290.8 bits (743), Expect = 3.1e-75 Identity = 153/177 (86.44%), Postives = 155/177 (87.57%), Query Frame = 0
BLAST of Carg02037 vs. NCBI nr
Match: XP_004147092.1 (PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cucumis sativus] >KGN51581.1 hypothetical protein Csa_5G580660 [Cucumis sativus]) HSP 1 Score: 241.9 bits (616), Expect = 1.7e-60 Identity = 150/181 (82.87%), Postives = 163/181 (90.06%), Query Frame = 0
BLAST of Carg02037 vs. NCBI nr
Match: XP_008445916.1 (PREDICTED: ferredoxin-thioredoxin reductase, variable chain [Cucumis melo]) HSP 1 Score: 239.2 bits (609), Expect = 1.1e-59 Identity = 148/181 (81.77%), Postives = 162/181 (89.50%), Query Frame = 0
BLAST of Carg02037 vs. TAIR10
Match: AT5G23440.1 (ferredoxin/thioredoxin reductase subunit A (variable subunit) 1) HSP 1 Score: 115.2 bits (287), Expect = 4.2e-26 Identity = 52/73 (71.23%), Postives = 62/73 (84.93%), Query Frame = 0
BLAST of Carg02037 vs. TAIR10
Match: AT5G08410.1 (ferredoxin/thioredoxin reductase subunit A (variable subunit) 2) HSP 1 Score: 102.1 bits (253), Expect = 3.7e-22 Identity = 44/67 (65.67%), Postives = 56/67 (83.58%), Query Frame = 0
BLAST of Carg02037 vs. Swiss-Prot
Match: sp|P80680|FTRV_MAIZE (Ferredoxin-thioredoxin reductase, variable chain OS=Zea mays OX=4577 PE=1 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 2.9e-24 Identity = 52/79 (65.82%), Postives = 66/79 (83.54%), Query Frame = 0
BLAST of Carg02037 vs. Swiss-Prot
Match: sp|P38365|FTRV_SPIOL (Ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Spinacia oleracea OX=3562 GN=FTRV PE=1 SV=2) HSP 1 Score: 91.7 bits (226), Expect = 9.0e-18 Identity = 44/79 (55.70%), Postives = 56/79 (70.89%), Query Frame = 0
BLAST of Carg02037 vs. Swiss-Prot
Match: sp|Q55781|FTRV_SYNY3 (Ferredoxin-thioredoxin reductase, variable chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ftrV PE=1 SV=1) HSP 1 Score: 45.4 bits (106), Expect = 7.4e-04 Identity = 28/75 (37.33%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of Carg02037 vs. TrEMBL
Match: tr|A0A0A0KV36|A0A0A0KV36_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G580660 PE=4 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 1.1e-60 Identity = 150/181 (82.87%), Postives = 163/181 (90.06%), Query Frame = 0
BLAST of Carg02037 vs. TrEMBL
Match: tr|A0A1S3BEI2|A0A1S3BEI2_CUCME (ferredoxin-thioredoxin reductase, variable chain OS=Cucumis melo OX=3656 GN=LOC103488798 PE=4 SV=1) HSP 1 Score: 239.2 bits (609), Expect = 7.1e-60 Identity = 148/181 (81.77%), Postives = 162/181 (89.50%), Query Frame = 0
BLAST of Carg02037 vs. TrEMBL
Match: tr|A0A2I4FXT9|A0A2I4FXT9_9ROSI (ferredoxin-thioredoxin reductase, variable chain, chloroplastic OS=Juglans regia OX=51240 GN=LOC109002985 PE=4 SV=1) HSP 1 Score: 132.5 bits (332), Expect = 9.3e-28 Identity = 81/185 (43.78%), Postives = 114/185 (61.62%), Query Frame = 0
BLAST of Carg02037 vs. TrEMBL
Match: tr|A0A200QK40|A0A200QK40_9MAGN (Lipoyl synthase OS=Macleaya cordata OX=56857 GN=BVC80_645g82 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.8e-26 Identity = 78/164 (47.56%), Postives = 101/164 (61.59%), Query Frame = 0
BLAST of Carg02037 vs. TrEMBL
Match: tr|A0A2P2IS21|A0A2P2IS21_RHIMU (Uncharacterized protein MANES_16G040000 OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 2.3e-26 Identity = 59/77 (76.62%), Postives = 68/77 (88.31%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|