Cla97C11G206950 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTTGAGGCTAGGGTTCCAATTCCTTACAGAGATCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATGTATGA ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTTGAGGCTAGGGTTCCAATTCCTTACAGAGATCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATGTATGA ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTTGAGGCTAGGGTTCCAATTCCTTACAGAGATCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATGTATGA MEVQGSSKKMIATQAEMVEARVPIPYRDQCAHLLIPLNKCRQSEFYLPWKCEDERHSYEKCEYELVMERMLQMQKIREEEAKLKKGIPLIPKTANV
BLAST of Cla97C11G206950 vs. NCBI nr
Match: XP_022158769.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Momordica charantia]) HSP 1 Score: 195.3 bits (495), Expect = 9.6e-47 Identity = 96/96 (100.00%), Postives = 96/96 (100.00%), Query Frame = 0
BLAST of Cla97C11G206950 vs. NCBI nr
Match: XP_022930015.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Cucurbita moschata] >XP_022994625.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Cucurbita maxima] >XP_023553585.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 191.8 bits (486), Expect = 1.1e-45 Identity = 94/96 (97.92%), Postives = 95/96 (98.96%), Query Frame = 0
BLAST of Cla97C11G206950 vs. NCBI nr
Match: XP_004140393.1 (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Cucumis sativus] >KGN50828.1 hypothetical protein Csa_5G277970 [Cucumis sativus]) HSP 1 Score: 190.7 bits (483), Expect = 2.4e-45 Identity = 94/96 (97.92%), Postives = 95/96 (98.96%), Query Frame = 0
BLAST of Cla97C11G206950 vs. NCBI nr
Match: XP_008460206.1 (PREDICTED: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Cucumis melo]) HSP 1 Score: 184.9 bits (468), Expect = 1.3e-43 Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 0
BLAST of Cla97C11G206950 vs. NCBI nr
Match: XP_006448039.1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Citrus clementina] >XP_006448041.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Citrus clementina] >XP_006492271.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Citrus sinensis] >XP_006492272.1 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 [Citrus sinensis] >ESR61279.1 hypothetical protein CICLE_v10017277mg [Citrus clementina] >ESR61280.1 hypothetical protein CICLE_v10017277mg [Citrus clementina] >ESR61281.1 hypothetical protein CICLE_v10017277mg [Citrus clementina] >KDO58623.1 hypothetical protein CISIN_1g034138mg [Citrus sinensis] >KDO58624.1 hypothetical protein CISIN_1g034138mg [Citrus sinensis] >KDO58625.1 hypothetical protein CISIN_1g034138mg [Citrus sinensis] >GAY51776.1 hypothetical protein CUMW_136810 [Citrus unshiu]) HSP 1 Score: 176.0 bits (445), Expect = 6.0e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TrEMBL
Match: tr|A0A0A0KMK8|A0A0A0KMK8_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G277970 PE=4 SV=1) HSP 1 Score: 190.7 bits (483), Expect = 1.6e-45 Identity = 94/96 (97.92%), Postives = 95/96 (98.96%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TrEMBL
Match: tr|A0A1S3CBZ9|A0A1S3CBZ9_CUCME (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Cucumis melo OX=3656 GN=LOC103499092 PE=4 SV=1) HSP 1 Score: 184.9 bits (468), Expect = 8.6e-44 Identity = 91/96 (94.79%), Postives = 93/96 (96.88%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TrEMBL
Match: tr|V4UAW1|V4UAW1_9ROSI (Uncharacterized protein OS=Citrus clementina OX=85681 GN=CICLE_v10017277mg PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 4.0e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TrEMBL
Match: tr|A0A067EXL1|A0A067EXL1_CITSI (Uncharacterized protein OS=Citrus sinensis OX=2711 GN=CISIN_1g034138mg PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 4.0e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TrEMBL
Match: tr|A0A2H5PHE2|A0A2H5PHE2_CITUN (Uncharacterized protein OS=Citrus unshiu OX=55188 GN=CUMW_136810 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 4.0e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 0
BLAST of Cla97C11G206950 vs. Swiss-Prot
Match: sp|Q9SKC9|NDUB7_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Arabidopsis thaliana OX=3702 GN=At2g02050 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 5.8e-35 Identity = 75/102 (73.53%), Postives = 82/102 (80.39%), Query Frame = 0
BLAST of Cla97C11G206950 vs. Swiss-Prot
Match: sp|Q54V61|NDUB7_DICDI (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Dictyostelium discoideum OX=44689 GN=ndufb7 PE=3 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 4.6e-16 Identity = 41/86 (47.67%), Postives = 60/86 (69.77%), Query Frame = 0
BLAST of Cla97C11G206950 vs. Swiss-Prot
Match: sp|Q0MQE4|NDUB7_PANTR (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pan troglodytes OX=9598 GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 57.8 bits (138), Expect = 7.8e-08 Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Cla97C11G206950 vs. Swiss-Prot
Match: sp|Q0MQE3|NDUB7_GORGO (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Gorilla gorilla gorilla OX=9595 GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Cla97C11G206950 vs. Swiss-Prot
Match: sp|Q0MQE2|NDUB7_PONPY (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pongo pygmaeus OX=9600 GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 57.4 bits (137), Expect = 1.0e-07 Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 0
BLAST of Cla97C11G206950 vs. TAIR10
Match: AT2G02050.1 (NADH-ubiquinone oxidoreductase B18 subunit, putative) HSP 1 Score: 147.9 bits (372), Expect = 3.2e-36 Identity = 75/102 (73.53%), Postives = 82/102 (80.39%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|