Lsi11G000470 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGTTCCAATTCCTTACAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATCTATGA ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGTTCCAATTCCTTACAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATCTATGA ATGGAAGTCCAGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGTTCCAATTCCTTACAGAGACCAGTGCGCTCACTTGTTGATCCCTCTTAATAAATGCCGCCAATCCGAGTTCTACCTCCCATGGAAATGCGAAGACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATGCTTCAGATGCAGAAGATCCGTGAGGAGGAGGCCAAGTTGAAGAAGGGTATTCCTCTCATTCCCAAAACTGCCAATCTATGA MEVQGSSKKMIATQAEMVEARVPIPYRDQCAHLLIPLNKCRQSEFYLPWKCEDERHSYEKCEYELVMERMLQMQKIREEEAKLKKGIPLIPKTANL
BLAST of Lsi11G000470 vs. Swiss-Prot
Match: NDUB7_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Arabidopsis thaliana GN=At2g02050 PE=3 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 5.7e-35 Identity = 75/102 (73.53%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of Lsi11G000470 vs. Swiss-Prot
Match: NDUB7_DICDI (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Dictyostelium discoideum GN=ndufb7 PE=3 SV=1) HSP 1 Score: 85.5 bits (210), Expect = 3.5e-16 Identity = 41/86 (47.67%), Postives = 60/86 (69.77%), Query Frame = 1
BLAST of Lsi11G000470 vs. Swiss-Prot
Match: NDUB7_PANTR (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pan troglodytes GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 58.9 bits (141), Expect = 3.5e-08 Identity = 36/89 (40.45%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Lsi11G000470 vs. Swiss-Prot
Match: NDUB7_GORGO (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Gorilla gorilla gorilla GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 58.5 bits (140), Expect = 4.5e-08 Identity = 36/89 (40.45%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Lsi11G000470 vs. Swiss-Prot
Match: NDUB7_PONPY (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Pongo pygmaeus GN=NDUFB7 PE=2 SV=3) HSP 1 Score: 58.5 bits (140), Expect = 4.5e-08 Identity = 36/89 (40.45%), Postives = 56/89 (62.92%), Query Frame = 1
BLAST of Lsi11G000470 vs. TrEMBL
Match: A0A0A0KMK8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G277970 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.4e-45 Identity = 93/96 (96.88%), Postives = 95/96 (98.96%), Query Frame = 1
BLAST of Lsi11G000470 vs. TrEMBL
Match: A0A067EXL1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g034138mg PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.2e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of Lsi11G000470 vs. TrEMBL
Match: V4UAW1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017277mg PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.2e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of Lsi11G000470 vs. TrEMBL
Match: A0A067KTF2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04846 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 2.2e-41 Identity = 88/101 (87.13%), Postives = 93/101 (92.08%), Query Frame = 1
BLAST of Lsi11G000470 vs. TrEMBL
Match: A0A0D2NDD0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G154900 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 8.2e-41 Identity = 87/101 (86.14%), Postives = 92/101 (91.09%), Query Frame = 1
BLAST of Lsi11G000470 vs. TAIR10
Match: AT2G02050.1 (AT2G02050.1 NADH-ubiquinone oxidoreductase B18 subunit, putative) HSP 1 Score: 147.9 bits (372), Expect = 3.2e-36 Identity = 75/102 (73.53%), Postives = 82/102 (80.39%), Query Frame = 1
BLAST of Lsi11G000470 vs. NCBI nr
Match: gi|449445264|ref|XP_004140393.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 189.9 bits (481), Expect = 2.1e-45 Identity = 93/96 (96.88%), Postives = 95/96 (98.96%), Query Frame = 1
BLAST of Lsi11G000470 vs. NCBI nr
Match: gi|659120462|ref|XP_008460206.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 184.1 bits (466), Expect = 1.1e-43 Identity = 90/96 (93.75%), Postives = 93/96 (96.88%), Query Frame = 1
BLAST of Lsi11G000470 vs. NCBI nr
Match: gi|802597738|ref|XP_012072408.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 176.0 bits (445), Expect = 3.1e-41 Identity = 88/101 (87.13%), Postives = 93/101 (92.08%), Query Frame = 1
BLAST of Lsi11G000470 vs. NCBI nr
Match: gi|567911451|ref|XP_006448039.1| (hypothetical protein CICLE_v10017277mg [Citrus clementina]) HSP 1 Score: 176.0 bits (445), Expect = 3.1e-41 Identity = 89/102 (87.25%), Postives = 92/102 (90.20%), Query Frame = 1
BLAST of Lsi11G000470 vs. NCBI nr
Match: gi|823158129|ref|XP_012478939.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 174.1 bits (440), Expect = 1.2e-40 Identity = 87/101 (86.14%), Postives = 92/101 (91.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|