CmaCh04G000010 (gene) Cucurbita maxima (Rimu)
The following sequences are available for this feature:
Legend: CDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGTGTCGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGCTCCAATCCCTTACCGAGACCTGTGCGCTCACTTGTTGATCCTTCTTAATAAGTGTCGCCAATCAGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATATTTCAGATGCTGAAGATCCGTGAGGAGGAGGCCAACTTGAAGAAGGGGATTAATCTCATTCCCAAAACTGCCAATGTATGA ATGGAAGTGTCGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGCTCCAATCCCTTACCGAGACCTGTGCGCTCACTTGTTGATCCTTCTTAATAAGTGTCGCCAATCAGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATATTTCAGATGCTGAAGATCCGTGAGGAGGAGGCCAACTTGAAGAAGGGGATTAATCTCATTCCCAAAACTGCCAATGTATGA ATGGAAGTGTCGGGCTCCTCGAAGAAGATGATAGCGACGCAGGCTGAGATGGTCGAGGCTAGGGCTCCAATCCCTTACCGAGACCTGTGCGCTCACTTGTTGATCCTTCTTAATAAGTGTCGCCAATCAGAGTTCTACCTCCCATGGAAATGCGAAAACGAGCGCCATTCCTACGAGAAGTGTGAATATGAGCTCGTTATGGAGAGGATATTTCAGATGCTGAAGATCCGTGAGGAGGAGGCCAACTTGAAGAAGGGGATTAATCTCATTCCCAAAACTGCCAATGTATGA MEVSGSSKKMIATQAEMVEARAPIPYRDLCAHLLILLNKCRQSEFYLPWKCENERHSYEKCEYELVMERIFQMLKIREEEANLKKGINLIPKTANV
BLAST of CmaCh04G000010 vs. Swiss-Prot
Match: NDUB7_ARATH (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Arabidopsis thaliana GN=At2g02050 PE=3 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 6.5e-31 Identity = 70/102 (68.63%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of CmaCh04G000010 vs. Swiss-Prot
Match: NDUB7_DICDI (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 OS=Dictyostelium discoideum GN=ndufb7 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.2e-14 Identity = 35/74 (47.30%), Postives = 52/74 (70.27%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TrEMBL
Match: A0A0A0KMK8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G277970 PE=4 SV=1) HSP 1 Score: 173.7 bits (439), Expect = 1.1e-40 Identity = 85/96 (88.54%), Postives = 89/96 (92.71%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TrEMBL
Match: A0A067EXL1_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g034138mg PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.6e-36 Identity = 82/102 (80.39%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TrEMBL
Match: V4UAW1_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10017277mg PE=4 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.6e-36 Identity = 82/102 (80.39%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TrEMBL
Match: A0A067KTF2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_04846 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 6.1e-36 Identity = 80/101 (79.21%), Postives = 85/101 (84.16%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TrEMBL
Match: A0A0D2NDD0_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_005G154900 PE=4 SV=1) HSP 1 Score: 155.2 bits (391), Expect = 4.0e-35 Identity = 79/101 (78.22%), Postives = 84/101 (83.17%), Query Frame = 1
BLAST of CmaCh04G000010 vs. TAIR10
Match: AT2G02050.1 (AT2G02050.1 NADH-ubiquinone oxidoreductase B18 subunit, putative) HSP 1 Score: 134.4 bits (337), Expect = 3.7e-32 Identity = 70/102 (68.63%), Postives = 78/102 (76.47%), Query Frame = 1
BLAST of CmaCh04G000010 vs. NCBI nr
Match: gi|449445264|ref|XP_004140393.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 173.7 bits (439), Expect = 1.5e-40 Identity = 85/96 (88.54%), Postives = 89/96 (92.71%), Query Frame = 1
BLAST of CmaCh04G000010 vs. NCBI nr
Match: gi|659120462|ref|XP_008460206.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 167.9 bits (424), Expect = 8.5e-39 Identity = 82/96 (85.42%), Postives = 87/96 (90.62%), Query Frame = 1
BLAST of CmaCh04G000010 vs. NCBI nr
Match: gi|567911451|ref|XP_006448039.1| (hypothetical protein CICLE_v10017277mg [Citrus clementina]) HSP 1 Score: 159.8 bits (403), Expect = 2.3e-36 Identity = 82/102 (80.39%), Postives = 85/102 (83.33%), Query Frame = 1
BLAST of CmaCh04G000010 vs. NCBI nr
Match: gi|802597738|ref|XP_012072408.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 157.9 bits (398), Expect = 8.8e-36 Identity = 80/101 (79.21%), Postives = 85/101 (84.16%), Query Frame = 1
BLAST of CmaCh04G000010 vs. NCBI nr
Match: gi|823158129|ref|XP_012478939.1| (PREDICTED: NADH dehydrogenase [ubiquinone]) HSP 1 Score: 155.2 bits (391), Expect = 5.7e-35 Identity = 79/101 (78.22%), Postives = 84/101 (83.17%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita maxima
Date Performed: 2017-05-20
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |