Cla013726 (gene) Watermelon (97103) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATTCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGATCAATTTCCAGATTGCCGGTTTGAGCCCTAA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATTCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGATCAATTTCCAGATTGCCGGTTTGAGCCCTAA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATTCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGATCAATTTCCAGATTGCCGGTTTGAGCCCTAA MSMDLEFPKNLPKIRLPLQVRSPPKPSLSDNIPSSASASASDHDSDIDRRACRTPTSAEHKIPKILSCPGAPKKPKRPPVPCKRKLTMELKFFEIVNQEEVDNFFRFLNLLPQRRRRGPAAGQPDQFPDCRFEP
BLAST of Cla013726 vs. Swiss-Prot
Match: SMR1_ARATH (Cyclin-dependent protein kinase inhibitor SMR1 OS=Arabidopsis thaliana GN=SMR1 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.7e-08 Identity = 43/118 (36.44%), Postives = 54/118 (45.76%), Query Frame = 1
BLAST of Cla013726 vs. Swiss-Prot
Match: SIM_ARATH (Cyclin-dependent protein kinase inhibitor SIM OS=Arabidopsis thaliana GN=SIM PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 9.1e-07 Identity = 33/85 (38.82%), Postives = 44/85 (51.76%), Query Frame = 1
BLAST of Cla013726 vs. TrEMBL
Match: A0A0A0LSQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G384460 PE=4 SV=1) HSP 1 Score: 198.4 bits (503), Expect = 5.7e-48 Identity = 97/106 (91.51%), Postives = 99/106 (93.40%), Query Frame = 1
BLAST of Cla013726 vs. TrEMBL
Match: W9S397_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_001720 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 5.2e-17 Identity = 58/124 (46.77%), Postives = 74/124 (59.68%), Query Frame = 1
BLAST of Cla013726 vs. TrEMBL
Match: A0A0D2Q6B6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G144400 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.8e-16 Identity = 47/106 (44.34%), Postives = 69/106 (65.09%), Query Frame = 1
BLAST of Cla013726 vs. TrEMBL
Match: M4M6N3_GOSAR (Cyclin-dependent protein kinase inhibitor Siamese OS=Gossypium arboreum PE=2 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.8e-16 Identity = 47/106 (44.34%), Postives = 69/106 (65.09%), Query Frame = 1
BLAST of Cla013726 vs. TrEMBL
Match: U5G4W0_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s02960g PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 9.8e-16 Identity = 60/122 (49.18%), Postives = 77/122 (63.11%), Query Frame = 1
BLAST of Cla013726 vs. NCBI nr
Match: gi|778672724|ref|XP_011649858.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Cucumis sativus]) HSP 1 Score: 198.4 bits (503), Expect = 8.2e-48 Identity = 97/106 (91.51%), Postives = 99/106 (93.40%), Query Frame = 1
BLAST of Cla013726 vs. NCBI nr
Match: gi|659113396|ref|XP_008456553.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo]) HSP 1 Score: 198.4 bits (503), Expect = 8.2e-48 Identity = 97/106 (91.51%), Postives = 99/106 (93.40%), Query Frame = 1
BLAST of Cla013726 vs. NCBI nr
Match: gi|703138808|ref|XP_010106827.1| (hypothetical protein L484_001720 [Morus notabilis]) HSP 1 Score: 95.5 bits (236), Expect = 7.5e-17 Identity = 58/124 (46.77%), Postives = 74/124 (59.68%), Query Frame = 1
BLAST of Cla013726 vs. NCBI nr
Match: gi|1009119912|ref|XP_015876638.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like isoform X1 [Ziziphus jujuba]) HSP 1 Score: 93.6 bits (231), Expect = 2.8e-16 Identity = 55/111 (49.55%), Postives = 70/111 (63.06%), Query Frame = 1
BLAST of Cla013726 vs. NCBI nr
Match: gi|459354680|gb|AGG55716.1| (cyclin-dependent protein kinase inhibitor Siamese [Gossypium arboreum]) HSP 1 Score: 91.3 bits (225), Expect = 1.4e-15 Identity = 47/106 (44.34%), Postives = 69/106 (65.09%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of watermelon (97103)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |