Cla97C08G150700 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTCCCTTTACAAGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATACCTTCTTCCGCCTCCGCCTCCGCCTCCGATCACGACTCCGACATCGACCGCCGCGCCTGCCGGACACCCACCTCCGCCGAACACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCCAAGAAGCCTAAACGCCCCCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTCAATCAAGAAGAGGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTACCACAGCGCCGCCGAAGAGGACCTGCTGCCGGTCAGCCTGA MSMDLEFPKNLPKIRLPLQVRSPPKPSLSDNIPSSASASASDHDSDIDRRACRTPTSAEHKIPKILSCPGAPKKPKRPPVPCKRKLTMELKFFEIVNQEEVDNFFRSAYDLESSTTAPPKRTCCRSA
BLAST of Cla97C08G150700 vs. NCBI nr
Match: XP_008456553.1 (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo]) HSP 1 Score: 214.5 bits (545), Expect = 2.0e-52 Identity = 110/126 (87.30%), Postives = 112/126 (88.89%), Query Frame = 0
BLAST of Cla97C08G150700 vs. NCBI nr
Match: XP_011649858.1 (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Cucumis sativus] >KGN63026.1 hypothetical protein Csa_2G384460 [Cucumis sativus]) HSP 1 Score: 214.2 bits (544), Expect = 2.6e-52 Identity = 110/126 (87.30%), Postives = 112/126 (88.89%), Query Frame = 0
BLAST of Cla97C08G150700 vs. NCBI nr
Match: XP_023521119.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 207.2 bits (526), Expect = 3.2e-50 Identity = 104/127 (81.89%), Postives = 110/127 (86.61%), Query Frame = 0
BLAST of Cla97C08G150700 vs. NCBI nr
Match: XP_022990487.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Cucurbita maxima]) HSP 1 Score: 205.3 bits (521), Expect = 1.2e-49 Identity = 103/127 (81.10%), Postives = 109/127 (85.83%), Query Frame = 0
BLAST of Cla97C08G150700 vs. NCBI nr
Match: XP_022923009.1 (cyclin-dependent protein kinase inhibitor SMR1-like [Cucurbita moschata]) HSP 1 Score: 204.1 bits (518), Expect = 2.7e-49 Identity = 103/127 (81.10%), Postives = 109/127 (85.83%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TrEMBL
Match: tr|A0A1S3C3L4|A0A1S3C3L4_CUCME (cyclin-dependent protein kinase inhibitor SMR1-like OS=Cucumis melo OX=3656 GN=LOC103496472 PE=4 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 1.3e-52 Identity = 110/126 (87.30%), Postives = 112/126 (88.89%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TrEMBL
Match: tr|A0A0A0LSQ6|A0A0A0LSQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G384460 PE=4 SV=1) HSP 1 Score: 214.2 bits (544), Expect = 1.8e-52 Identity = 110/126 (87.30%), Postives = 112/126 (88.89%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TrEMBL
Match: tr|W9S397|W9S397_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_001720 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 5.3e-17 Identity = 63/142 (44.37%), Postives = 81/142 (57.04%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TrEMBL
Match: tr|A0A2I4DNM2|A0A2I4DNM2_9ROSI (cyclin-dependent protein kinase inhibitor SMR1-like OS=Juglans regia OX=51240 GN=LOC108981948 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 7.0e-17 Identity = 61/127 (48.03%), Postives = 82/127 (64.57%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TrEMBL
Match: tr|A0A2I4GVZ7|A0A2I4GVZ7_9ROSI (cyclin-dependent protein kinase inhibitor SMR1-like OS=Juglans regia OX=51240 GN=LOC109011361 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 2.9e-15 Identity = 53/124 (42.74%), Postives = 75/124 (60.48%), Query Frame = 0
BLAST of Cla97C08G150700 vs. Swiss-Prot
Match: sp|Q9SGE2|SMR2_ARATH (Cyclin-dependent protein kinase inhibitor SMR2 OS=Arabidopsis thaliana OX=3702 GN=SMR2 PE=1 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 7.0e-04 Identity = 23/55 (41.82%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TAIR10
Match: AT1G08180.1 (unknown protein) HSP 1 Score: 45.1 bits (105), Expect = 3.9e-05 Identity = 23/55 (41.82%), Postives = 37/55 (67.27%), Query Frame = 0
BLAST of Cla97C08G150700 vs. TAIR10
Match: AT5G02420.1 (unknown protein) HSP 1 Score: 41.2 bits (95), Expect = 5.6e-04 Identity = 32/87 (36.78%), Postives = 44/87 (50.57%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |