Cucsa.163110 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTTCCTTTACAGGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATCATACCCTCTTCCGATCATGACTCCGACCTCGACCGCCGTTCCTGCCGGACACCCACCTCCGCCGAGCACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCTAAGAAGCCTAAACGCCCTCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTTAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTCCCACTGCGCCGCCTAAGAGGAGTTGCTGCCGGCCGTCAGCTTGA ATGTCTATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTTCCTTTACAGGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATCATACCCTCTTCCGATCATGACTCCGACCTCGACCGCCGTTCCTGCCGGACACCCACCTCCGCCGAGCACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCTAAGAAGCCTAAACGCCCTCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTTAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTCCCACTGCGCCGCCTAAGAGGAGTTGCTGCCGGCCGTCAGCTTGA ATGTCTATGGACCTTGAATTCCCCAAAAATCTCCCCAAAATCCGCCTTCCTTTACAGGTCCGATCCCCTCCCAAACCCTCCCTTTCCGACAACATCATACCCTCTTCCGATCATGACTCCGACCTCGACCGCCGTTCCTGCCGGACACCCACCTCCGCCGAGCACAAGATTCCCAAGATCCTCAGCTGTCCTGGCGCTCCTAAGAAGCCTAAACGCCCTCCAGTCCCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTCGAGATCGTTAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTTGAATCTTCTCCCACTGCGCCGCCTAAGAGGAGTTGCTGCCGGCCGTCAGCTTGA MSMDLEFPKNLPKIRLPLQVRSPPKPSLSDNIIPSSDHDSDLDRRSCRTPTSAEHKIPKILSCPGAPKKPKRPPVPCKRKLTMELKFFEIVNQEEVDNFFRSAYDLESSPTAPPKRSCCRPSA*
BLAST of Cucsa.163110 vs. Swiss-Prot
Match: SMR1_ARATH (Cyclin-dependent protein kinase inhibitor SMR1 OS=Arabidopsis thaliana GN=SMR1 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 6.7e-12 Identity = 51/130 (39.23%), Postives = 68/130 (52.31%), Query Frame = 1
BLAST of Cucsa.163110 vs. Swiss-Prot
Match: SIM_ARATH (Cyclin-dependent protein kinase inhibitor SIM OS=Arabidopsis thaliana GN=SIM PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 2.0e-08 Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 1
BLAST of Cucsa.163110 vs. Swiss-Prot
Match: SMR3_ARATH (Cyclin-dependent protein kinase inhibitor SMR3 OS=Arabidopsis thaliana GN=SMR3 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.5e-06 Identity = 34/84 (40.48%), Postives = 46/84 (54.76%), Query Frame = 1
BLAST of Cucsa.163110 vs. TrEMBL
Match: A0A0A0LSQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G384460 PE=4 SV=1) HSP 1 Score: 258.5 bits (659), Expect = 4.3e-66 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 1
BLAST of Cucsa.163110 vs. TrEMBL
Match: W9S397_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_001720 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.7e-20 Identity = 65/142 (45.77%), Postives = 81/142 (57.04%), Query Frame = 1
BLAST of Cucsa.163110 vs. TrEMBL
Match: M4M6N3_GOSAR (Cyclin-dependent protein kinase inhibitor Siamese OS=Gossypium arboreum PE=2 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 6.3e-17 Identity = 53/119 (44.54%), Postives = 75/119 (63.03%), Query Frame = 1
BLAST of Cucsa.163110 vs. TrEMBL
Match: A0A067L9G3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_01562 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 6.3e-17 Identity = 57/122 (46.72%), Postives = 78/122 (63.93%), Query Frame = 1
BLAST of Cucsa.163110 vs. TrEMBL
Match: A0A0D2Q6B6_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_002G144400 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 6.3e-17 Identity = 53/119 (44.54%), Postives = 75/119 (63.03%), Query Frame = 1
BLAST of Cucsa.163110 vs. TAIR10
Match: AT3G10525.1 (AT3G10525.1 LOSS OF GIANT CELLS FROM ORGANS) HSP 1 Score: 71.6 bits (174), Expect = 3.8e-13 Identity = 51/130 (39.23%), Postives = 68/130 (52.31%), Query Frame = 1
BLAST of Cucsa.163110 vs. TAIR10
Match: AT5G04470.1 (AT5G04470.1 cyclin-dependent protein kinase inhibitors) HSP 1 Score: 60.1 bits (144), Expect = 1.1e-09 Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 1
BLAST of Cucsa.163110 vs. TAIR10
Match: AT5G02420.1 (AT5G02420.1 unknown protein) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-07 Identity = 34/84 (40.48%), Postives = 46/84 (54.76%), Query Frame = 1
BLAST of Cucsa.163110 vs. TAIR10
Match: AT1G08180.1 (AT1G08180.1 unknown protein) HSP 1 Score: 47.8 bits (112), Expect = 5.8e-06 Identity = 29/84 (34.52%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of Cucsa.163110 vs. NCBI nr
Match: gi|778672724|ref|XP_011649858.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Cucumis sativus]) HSP 1 Score: 258.5 bits (659), Expect = 6.2e-66 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 1
BLAST of Cucsa.163110 vs. NCBI nr
Match: gi|659113396|ref|XP_008456553.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo]) HSP 1 Score: 254.2 bits (648), Expect = 1.2e-64 Identity = 121/123 (98.37%), Postives = 122/123 (99.19%), Query Frame = 1
BLAST of Cucsa.163110 vs. NCBI nr
Match: gi|1009119912|ref|XP_015876638.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like isoform X1 [Ziziphus jujuba]) HSP 1 Score: 109.0 bits (271), Expect = 6.0e-21 Identity = 62/128 (48.44%), Postives = 83/128 (64.84%), Query Frame = 1
BLAST of Cucsa.163110 vs. NCBI nr
Match: gi|703138808|ref|XP_010106827.1| (hypothetical protein L484_001720 [Morus notabilis]) HSP 1 Score: 106.3 bits (264), Expect = 3.9e-20 Identity = 65/142 (45.77%), Postives = 81/142 (57.04%), Query Frame = 1
BLAST of Cucsa.163110 vs. NCBI nr
Match: gi|802547466|ref|XP_012090347.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Jatropha curcas]) HSP 1 Score: 95.1 bits (235), Expect = 9.0e-17 Identity = 57/122 (46.72%), Postives = 78/122 (63.93%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|