Cp4.1LG01g24760 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCCATGGACCTTGAATTTCCTGAAAATCTCCCTAAAATCCGCCTTCCTTTACAGGTTCGATCGCCTCCTAAGCCTTCCAATTCCATCAACATCCCTTCCTCCGTCTCCGATCACGACGGCGCCGACCTTGACCACCGCGGCTGCCGGACGCCGACCTCTGCTGAGCACAAGATTCCGAAGATCATCAGCTGTCCTGGAGCGCCGAGGAAGCCGAAGCGTCCTCCCGTACCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTTGAGTTCGTGAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTCGAAGCTTCTTCCACGGCGCCGCCGAAGAGGAGCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTTCCTGAAAATCTCCCTAAAATCCGCCTTCCTTTACAGGTTCGATCGCCTCCTAAGCCTTCCAATTCCATCAACATCCCTTCCTCCGTCTCCGATCACGACGGCGCCGACCTTGACCACCGCGGCTGCCGGACGCCGACCTCTGCTGAGCACAAGATTCCGAAGATCATCAGCTGTCCTGGAGCGCCGAGGAAGCCGAAGCGTCCTCCCGTACCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTTGAGTTCGTGAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTCGAAGCTTCTTCCACGGCGCCGCCGAAGAGGAGCTGCTGCCGGTCAGCCTGA ATGTCCATGGACCTTGAATTTCCTGAAAATCTCCCTAAAATCCGCCTTCCTTTACAGGTTCGATCGCCTCCTAAGCCTTCCAATTCCATCAACATCCCTTCCTCCGTCTCCGATCACGACGGCGCCGACCTTGACCACCGCGGCTGCCGGACGCCGACCTCTGCTGAGCACAAGATTCCGAAGATCATCAGCTGTCCTGGAGCGCCGAGGAAGCCGAAGCGTCCTCCCGTACCTTGCAAGAGGAAGTTGACCATGGAGCTCAAATTCTTTGAGTTCGTGAATCAAGAAGAAGTCGATAATTTCTTCCGATCCGCTTACGATCTCGAAGCTTCTTCCACGGCGCCGCCGAAGAGGAGCTGCTGCCGGTCAGCCTGA MSMDLEFPENLPKIRLPLQVRSPPKPSNSINIPSSVSDHDGADLDHRGCRTPTSAEHKIPKIISCPGAPRKPKRPPVPCKRKLTMELKFFEFVNQEEVDNFFRSAYDLEASSTAPPKRSCCRSA
BLAST of Cp4.1LG01g24760 vs. Swiss-Prot
Match: SMR1_ARATH (Cyclin-dependent protein kinase inhibitor SMR1 OS=Arabidopsis thaliana GN=SMR1 PE=1 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 3.7e-10 Identity = 51/132 (38.64%), Postives = 66/132 (50.00%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. Swiss-Prot
Match: SIM_ARATH (Cyclin-dependent protein kinase inhibitor SIM OS=Arabidopsis thaliana GN=SIM PE=1 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 5.8e-08 Identity = 39/121 (32.23%), Postives = 60/121 (49.59%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TrEMBL
Match: A0A0A0LSQ6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G384460 PE=4 SV=1) HSP 1 Score: 211.8 bits (538), Expect = 4.6e-52 Identity = 107/122 (87.70%), Postives = 112/122 (91.80%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TrEMBL
Match: W9S397_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_001720 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.3e-18 Identity = 66/143 (46.15%), Postives = 87/143 (60.84%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TrEMBL
Match: M5X1M1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013617mg PE=4 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 4.5e-15 Identity = 55/121 (45.45%), Postives = 73/121 (60.33%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TrEMBL
Match: U5G4W0_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s02960g PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 5.9e-15 Identity = 52/120 (43.33%), Postives = 77/120 (64.17%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TrEMBL
Match: A0A067L9G3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_01562 PE=4 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.3e-14 Identity = 54/123 (43.90%), Postives = 75/123 (60.98%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TAIR10
Match: AT3G10525.1 (AT3G10525.1 LOSS OF GIANT CELLS FROM ORGANS) HSP 1 Score: 65.9 bits (159), Expect = 2.1e-11 Identity = 51/132 (38.64%), Postives = 66/132 (50.00%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TAIR10
Match: AT5G04470.1 (AT5G04470.1 cyclin-dependent protein kinase inhibitors) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-09 Identity = 39/121 (32.23%), Postives = 60/121 (49.59%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. TAIR10
Match: AT5G02420.1 (AT5G02420.1 unknown protein) HSP 1 Score: 48.9 bits (115), Expect = 2.6e-06 Identity = 35/80 (43.75%), Postives = 46/80 (57.50%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. NCBI nr
Match: gi|659113396|ref|XP_008456553.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like [Cucumis melo]) HSP 1 Score: 212.6 bits (540), Expect = 3.9e-52 Identity = 107/122 (87.70%), Postives = 113/122 (92.62%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. NCBI nr
Match: gi|778672724|ref|XP_011649858.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1 [Cucumis sativus]) HSP 1 Score: 211.8 bits (538), Expect = 6.6e-52 Identity = 107/122 (87.70%), Postives = 112/122 (91.80%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. NCBI nr
Match: gi|1009119912|ref|XP_015876638.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR1-like isoform X1 [Ziziphus jujuba]) HSP 1 Score: 101.3 bits (251), Expect = 1.3e-18 Identity = 64/131 (48.85%), Postives = 84/131 (64.12%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. NCBI nr
Match: gi|703138808|ref|XP_010106827.1| (hypothetical protein L484_001720 [Morus notabilis]) HSP 1 Score: 99.4 bits (246), Expect = 4.8e-18 Identity = 66/143 (46.15%), Postives = 87/143 (60.84%), Query Frame = 1
BLAST of Cp4.1LG01g24760 vs. NCBI nr
Match: gi|645252301|ref|XP_008232059.1| (PREDICTED: cyclin-dependent protein kinase inhibitor SMR3 [Prunus mume]) HSP 1 Score: 89.4 bits (220), Expect = 4.9e-15 Identity = 56/121 (46.28%), Postives = 72/121 (59.50%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |