ClCG10G010350 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTGGAAGAGAGTTGGGTTGGTGGCTGTGGTAGGGATGCTGATAATGGCTGCTTTGGTGGAGGAGTGTGTAGCCATTGAAGCACAGTCTGTGGGAGGTTTGAATAAAAATGAATTCCCAAGAAAGATGATGAATGAAGATTATGATAATGTTAATAAAGGAAGAATGTGCCCTAGAATCCTTCAGGAGTGCACTACTGATGATGATTGCATGAATGACTGCATTTGCCTCTCTAATGGCTTTTGTGGTTGA ATGGAGTGGAAGAGAGTTGGGTTGGTGGCTGTGGTAGGGATGCTGATAATGGCTGCTTTGGTGGAGGAGTGTGTAGCCATTGAAGCACAGTCTGTGGGAGGTTTGAATAAAAATGAATTCCCAAGAAAGATGATGAATGAAGATTATGATAATGTTAATAAAGGAAGAATGTGCCCTAGAATCCTTCAGGAGTGCACTACTGATGATGATTGCATGAATGACTGCATTTGCCTCTCTAATGGCTTTTGTGGTTGA ATGGAGTGGAAGAGAGTTGGGTTGGTGGCTGTGGTAGGGATGCTGATAATGGCTGCTTTGGTGGAGGAGTGTGTAGCCATTGAAGCACAGTCTGTGGGAGGTTTGAATAAAAATGAATTCCCAAGAAAGATGATGAATGAAGATTATGATAATGTTAATAAAGGAAGAATGTGCCCTAGAATCCTTCAGGAGTGCACTACTGATGATGATTGCATGAATGACTGCATTTGCCTCTCTAATGGCTTTTGTGGTTGA MEWKRVGLVAVVGMLIMAALVEECVAIEAQSVGGLNKNEFPRKMMNEDYDNVNKGRMCPRILQECTTDDDCMNDCICLSNGFCG
BLAST of ClCG10G010350 vs. Swiss-Prot
Match: ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.5e-10 Identity = 31/68 (45.59%), Postives = 39/68 (57.35%), Query Frame = 1
BLAST of ClCG10G010350 vs. Swiss-Prot
Match: ITR3_LUFAE (Trypsin inhibitor 3 OS=Luffa aegyptiaca PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.6e-07 Identity = 20/29 (68.97%), Postives = 23/29 (79.31%), Query Frame = 1
BLAST of ClCG10G010350 vs. Swiss-Prot
Match: ITR1_LUFAE (Trypsin inhibitor 1 OS=Luffa aegyptiaca PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.3e-06 Identity = 19/29 (65.52%), Postives = 22/29 (75.86%), Query Frame = 1
BLAST of ClCG10G010350 vs. Swiss-Prot
Match: ITR3_CUCMC (Trypsin inhibitor 3 OS=Cucumis melo var. conomon PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.8e-06 Identity = 18/29 (62.07%), Postives = 20/29 (68.97%), Query Frame = 1
BLAST of ClCG10G010350 vs. Swiss-Prot
Match: ITR4_CYCPE (Trypsin inhibitor 4 OS=Cyclanthera pedata PE=1 SV=1) HSP 1 Score: 51.6 bits (122), Expect = 4.8e-06 Identity = 19/29 (65.52%), Postives = 19/29 (65.52%), Query Frame = 1
BLAST of ClCG10G010350 vs. TrEMBL
Match: A0A0A0KT01_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G000805 PE=3 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.7e-29 Identity = 64/85 (75.29%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of ClCG10G010350 vs. TrEMBL
Match: A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-07 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 1
BLAST of ClCG10G010350 vs. NCBI nr
Match: gi|778697386|ref|XP_011654311.1| (PREDICTED: uncharacterized protein LOC105435333 [Cucumis sativus]) HSP 1 Score: 136.3 bits (342), Expect = 2.4e-29 Identity = 64/85 (75.29%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of ClCG10G010350 vs. NCBI nr
Match: gi|778697386|ref|XP_011654311.1| (PREDICTED: uncharacterized protein LOC105435333 [Cucumis sativus]) HSP 1 Score: 134.0 bits (336), Expect = 1.2e-28 Identity = 63/84 (75.00%), Postives = 73/84 (86.90%), Query Frame = 1
HSP 2 Score: 136.3 bits (342), Expect = 2.4e-29 Identity = 64/85 (75.29%), Postives = 74/85 (87.06%), Query Frame = 1
BLAST of ClCG10G010350 vs. NCBI nr
Match: gi|462426|sp|P34950.1|ITR5_LUFAE (RecName: Full=Trypsin inhibitor 5; AltName: Full=TGT-II; AltName: Full=Trypsin inhibitor II; Flags: Precursor) HSP 1 Score: 64.7 bits (156), Expect = 8.8e-08 Identity = 31/68 (45.59%), Postives = 41/68 (60.29%), Query Frame = 1
BLAST of ClCG10G010350 vs. NCBI nr
Match: gi|700197603|gb|KGN52761.1| (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 62.8 bits (151), Expect = 3.4e-07 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |