Cp4.1LG14g04630 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTGGAAAAGAGGTGCTTTAATTGCCATGGTGGGGCTGTTGCTGATGGCGGCTTTTGCAGACTCCGCCGCCGTCCATGGCGGCGAAGTGATTCAGCTAGTTTCCGACGGAGTGAATGATTTCCCAAGGAAGATGATGAACGCTGCCCTTGGTTGCCCTAGAATCCTTATGGAGTGCGAAGTGGATTCCGACTGCCTTCCTGGTTGCGTATGCCGGCCCAACGGCTTCTGTGGTTGA ATGGAGTGGAAAAGAGGTGCTTTAATTGCCATGGTGGGGCTGTTGCTGATGGCGGCTTTTGCAGACTCCGCCGCCGTCCATGGCGGCGAAGTGATTCAGCTAGTTTCCGACGGAGTGAATGATTTCCCAAGGAAGATGATGAACGCTGCCCTTGGTTGCCCTAGAATCCTTATGGAGTGCGAAGTGGATTCCGACTGCCTTCCTGGTTGCGTATGCCGGCCCAACGGCTTCTGTGGTTGA ATGGAGTGGAAAAGAGGTGCTTTAATTGCCATGGTGGGGCTGTTGCTGATGGCGGCTTTTGCAGACTCCGCCGCCGTCCATGGCGGCGAAGTGATTCAGCTAGTTTCCGACGGAGTGAATGATTTCCCAAGGAAGATGATGAACGCTGCCCTTGGTTGCCCTAGAATCCTTATGGAGTGCGAAGTGGATTCCGACTGCCTTCCTGGTTGCGTATGCCGGCCCAACGGCTTCTGTGGTTGA MEWKRGALIAMVGLLLMAAFADSAAVHGGEVIQLVSDGVNDFPRKMMNAALGCPRILMECEVDSDCLPGCVCRPNGFCG
BLAST of Cp4.1LG14g04630 vs. Swiss-Prot
Match: ITR1_TRIKI (Trypsin inhibitor 1 OS=Trichosanthes kirilowii PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 8.3e-16 Identity = 39/65 (60.00%), Postives = 46/65 (70.77%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. Swiss-Prot
Match: ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca PE=1 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.6e-12 Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. Swiss-Prot
Match: ITR2_ECBEL (Trypsin inhibitor 2 OS=Ecballium elaterium PE=1 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 2.2e-08 Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. Swiss-Prot
Match: ITR2_BRYDI (Trypsin inhibitor 2 OS=Bryonia dioica PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.4e-07 Identity = 21/28 (75.00%), Postives = 24/28 (85.71%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. Swiss-Prot
Match: ITR5_SECED (Trypsin inhibitor 5 OS=Sechium edule PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 4.1e-07 Identity = 19/27 (70.37%), Postives = 24/27 (88.89%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. TrEMBL
Match: A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.2e-18 Identity = 46/81 (56.79%), Postives = 62/81 (76.54%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. TrEMBL
Match: A0A0A0KT01_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G000805 PE=3 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 7.3e-11 Identity = 39/82 (47.56%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. TrEMBL
Match: A0A0A0KV23_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G000835 PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.2e-06 Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. TrEMBL
Match: A0A0A7HF87_9ROSI (TIPTOP4 protein OS=Momordica subangulata GN=TIPTOP4 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.4e-06 Identity = 32/80 (40.00%), Postives = 45/80 (56.25%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. NCBI nr
Match: gi|700197603|gb|KGN52761.1| (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 100.1 bits (248), Expect = 1.8e-18 Identity = 46/81 (56.79%), Postives = 62/81 (76.54%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. NCBI nr
Match: gi|8134511|sp|Q43667.1|ITR1_TRIKI (RecName: Full=Trypsin inhibitor 1; AltName: Full=TTII; AltName: Full=Trypsin inhibitor I; Flags: Precursor) HSP 1 Score: 84.0 bits (206), Expect = 1.3e-13 Identity = 39/65 (60.00%), Postives = 46/65 (70.77%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. NCBI nr
Match: gi|778697386|ref|XP_011654311.1| (PREDICTED: uncharacterized protein LOC105435333 [Cucumis sativus]) HSP 1 Score: 74.3 bits (181), Expect = 1.0e-10 Identity = 39/82 (47.56%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. NCBI nr
Match: gi|700197602|gb|KGN52760.1| (hypothetical protein Csa_4G000805 [Cucumis sativus]) HSP 1 Score: 74.3 bits (181), Expect = 1.0e-10 Identity = 39/82 (47.56%), Postives = 50/82 (60.98%), Query Frame = 1
BLAST of Cp4.1LG14g04630 vs. NCBI nr
Match: gi|462426|sp|P34950.1|ITR5_LUFAE (RecName: Full=Trypsin inhibitor 5; AltName: Full=TGT-II; AltName: Full=Trypsin inhibitor II; Flags: Precursor) HSP 1 Score: 71.2 bits (173), Expect = 8.9e-10 Identity = 35/65 (53.85%), Postives = 45/65 (69.23%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |