MELO3C018005 (gene) Melon (DHL92) v3.5.1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AAAGAGATCAATCAAGAAAGAGTGGGAAAGTAAAGATAGAGAGAGAGAGAGAAGAAAAAATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCCGTCGGTTTCGGCGTCGATGAGGAGATTATTCAACTAGTTTCTGACGGAGTGAATGAATACTCGGGTCATCCAGGTTGTCCTAGAATTCTTATGAAGTGTAAAACCGACCGCGATTGTTTGGCAGGCTGCACTTGCAAGCGAAACGGCTATTGTGGTTGACACTTTGCCGTGTCGTGTTTGAAGAAGCTCCCCGTCCTGTGTCGTGCTTCATTTTCTCTACAATGTCTTTGTGTCATATTTTCGTCTTCTCTACTTTTATGAAAATAAATACACCTTTATGTCTCTTTATGATCACTTCTCTGGTTTATGAGTTAAATGTGATCAATTTGGTGACAGTGTTAGATTGAATATCAAGGTGTCTTGTTGTAATATTTATTATGTTTTTTTTTTCTATGACAGTACGGTATGAGGCTATCTTGGTTATTTCTTACATGGA AAAGAGATCAATCAAGAAAGAGTGGGAAAGTAAAGATAGAGAGAGAGAGAGAAGAAAAAATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCCGTCGGTTTCGGCGTCGATGAGGAGATTATTCAACTAGTTTCTGACGGAGTGAATGAATACTCGGGTCATCCAGGTTGTCCTAGAATTCTTATGAAGTGTAAAACCGACCGCGATTGTTTGGCAGGCTGCACTTGCAAGCGAAACGGCTATTGTGGTTGACACTTTGCCGTGTCGTGTTTGAAGAAGCTCCCCGTCCTGTGTCGTGCTTCATTTTCTCTACAATGTCTTTGTGTCATATTTTCGTCTTCTCTACTTTTATGAAAATAAATACACCTTTATGTCTCTTTATGATCACTTCTCTGGTTTATGAGTTAAATGTGATCAATTTGGTGACAGTGTTAGATTGAATATCAAGGTGTCTTGTTGTAATATTTATTATGTTTTTTTTTTCTATGACAGTACGGTATGAGGCTATCTTGGTTATTTCTTACATGGA ATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCCGTCGGTTTCGGCGTCGATGAGGAGATTATTCAACTAGTTTCTGACGGAGTGAATGAATACTCGGGTCATCCAGGTTGTCCTAGAATTCTTATGAAGTGTAAAACCGACCGCGATTGTTTGGCAGGCTGCACTTGCAAGCGAAACGGCTATTGTGGTTGA MEWKKIALVAMMGMLLMATFTESVGFGVDEEIIQLVSDGVNEYSGHPGCPRILMKCKTDRDCLAGCTCKRNGYCG*
BLAST of MELO3C018005 vs. Swiss-Prot
Match: ITR1_TRIKI (Trypsin inhibitor 1 OS=Trichosanthes kirilowii PE=3 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.2e-13 Identity = 39/65 (60.00%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of MELO3C018005 vs. Swiss-Prot
Match: ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca PE=1 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.5e-09 Identity = 34/66 (51.52%), Postives = 38/66 (57.58%), Query Frame = 1
BLAST of MELO3C018005 vs. Swiss-Prot
Match: ITR2_BRYDI (Trypsin inhibitor 2 OS=Bryonia dioica PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.2e-08 Identity = 22/28 (78.57%), Postives = 23/28 (82.14%), Query Frame = 1
BLAST of MELO3C018005 vs. Swiss-Prot
Match: ITR2_ECBEL (Trypsin inhibitor 2 OS=Ecballium elaterium PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 2.3e-07 Identity = 21/28 (75.00%), Postives = 21/28 (75.00%), Query Frame = 1
BLAST of MELO3C018005 vs. Swiss-Prot
Match: ITR1_MOMRE (Trypsin inhibitor 1 OS=Momordica repens PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.2e-07 Identity = 21/27 (77.78%), Postives = 20/27 (74.07%), Query Frame = 1
BLAST of MELO3C018005 vs. TrEMBL
Match: A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 1.5e-29 Identity = 67/81 (82.72%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of MELO3C018005 vs. TrEMBL
Match: Q9S8D2_CUCME (CMETI-B=TRYPSIN inhibitor OS=Cucumis melo PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.0e-09 Identity = 27/28 (96.43%), Postives = 27/28 (96.43%), Query Frame = 1
BLAST of MELO3C018005 vs. TrEMBL
Match: J3R2I9_MOMCO (Two inhibitor peptide topologies 2 OS=Momordica cochinchinensis GN=TIPTOP2 PE=2 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.9e-08 Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 1
BLAST of MELO3C018005 vs. TrEMBL
Match: J3R2I9_MOMCO (Two inhibitor peptide topologies 2 OS=Momordica cochinchinensis GN=TIPTOP2 PE=2 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-03 Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 4.1e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 3 Score: 48.5 bits (114), Expect = 4.1e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 4 Score: 47.8 bits (112), Expect = 7.0e-03 Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 5 Score: 46.2 bits (108), Expect = 2.0e-02 Identity = 16/27 (59.26%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 6 Score: 66.2 bits (160), Expect = 1.9e-08 Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 1
BLAST of MELO3C018005 vs. TrEMBL
Match: J3RCD6_MOMCO (Two inhibitor peptide topologies 1 OS=Momordica cochinchinensis GN=TIPTOP1 PE=2 SV=1) HSP 1 Score: 48.5 bits (114), Expect = 4.1e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 4.1e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 3 Score: 47.8 bits (112), Expect = 7.0e-03 Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 4 Score: 46.2 bits (108), Expect = 2.0e-02 Identity = 16/27 (59.26%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 5 Score: 65.9 bits (159), Expect = 2.5e-08 Identity = 33/81 (40.74%), Postives = 47/81 (58.02%), Query Frame = 1
BLAST of MELO3C018005 vs. NCBI nr
Match: gi|700197603|gb|KGN52761.1| (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 136.3 bits (342), Expect = 2.2e-29 Identity = 67/81 (82.72%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of MELO3C018005 vs. NCBI nr
Match: gi|8134511|sp|Q43667.1|ITR1_TRIKI (RecName: Full=Trypsin inhibitor 1; AltName: Full=TTII; AltName: Full=Trypsin inhibitor I; Flags: Precursor) HSP 1 Score: 75.9 bits (185), Expect = 3.5e-11 Identity = 39/65 (60.00%), Postives = 42/65 (64.62%), Query Frame = 1
BLAST of MELO3C018005 vs. NCBI nr
Match: gi|1246050|gb|AAB35852.1| (CMeTI-B=trypsin inhibitor [Cucumis melo=melons, seeds, Peptide, 29 aa]) HSP 1 Score: 68.9 bits (167), Expect = 4.2e-09 Identity = 27/28 (96.43%), Postives = 27/28 (96.43%), Query Frame = 1
BLAST of MELO3C018005 vs. NCBI nr
Match: gi|340796234|gb|AEK70373.1| (two inhibitor peptide topologies precursor 2 [Momordica cochinchinensis]) HSP 1 Score: 66.2 bits (160), Expect = 2.7e-08 Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 1
BLAST of MELO3C018005 vs. NCBI nr
Match: gi|340796234|gb|AEK70373.1| (two inhibitor peptide topologies precursor 2 [Momordica cochinchinensis]) HSP 1 Score: 50.4 bits (119), Expect = 1.6e-03 Identity = 22/42 (52.38%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 2 Score: 48.5 bits (114), Expect = 5.9e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 3 Score: 48.5 bits (114), Expect = 5.9e-03 Identity = 21/42 (50.00%), Postives = 27/42 (64.29%), Query Frame = 1
HSP 4 Score: 47.8 bits (112), Expect = 1.0e-02 Identity = 18/27 (66.67%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 5 Score: 46.2 bits (108), Expect = 2.9e-02 Identity = 16/27 (59.26%), Postives = 19/27 (70.37%), Query Frame = 1
HSP 6 Score: 66.2 bits (160), Expect = 2.7e-08 Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
This gene is associated with the following unigenes:
The following mRNA feature(s) are a part of this gene:
The following transcribed_cluster feature(s) are associated with this gene:
Analysis Name: InterPro Annotations of melon
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |