Carg19685 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGGCAAAACGAGATGACACAAATGGGCATTGCCAGCCAGATGCAATACACATTCTTATCATTCAAGTTTCAACGTCAAATTGGGAGCAAAATCTCCTCTTTCTCTTCTATAAAATGGTACCCAAACAGACAAGAGGTACTAACAAAAAGACCTGAAATGGGTAGCATGAAGATTGTCGCGGTGGCTCTAATCGCAATTTTGCTGGTAGCAACGTTGTCGTCGGCTGCCTATGCCATCGACGACGACTCGATGGACCTTGTCTTCGACGGTCGAGACATCAATCATGGAGTCCCAAGAAAGATCATGAAATGGGGAGTGCTTAATCATGAAGAAAGGGTATGTCCCAAAATCCTCATGGAATGCAAAAAGGACTCTGATTGCTTAGCTGAGTGTATCTGTCTCGAGCATGGATATTGTGGCTAA ATGTGGCAAAACGAGATGACACAAATGGGCATTGCCAGCCAGATGCAATACACATTCTTATCATTCAAGTTTCAACGTCAAATTGGGAGCAAAATCTCCTCTTTCTCTTCTATAAAATGGTACCCAAACAGACAAGAGGTACTAACAAAAAGACCTGAAATGGGTAGCATGAAGATTGTCGCGGTGGCTCTAATCGCAATTTTGCTGGTAGCAACGTTGTCGTCGGCTGCCTATGCCATCGACGACGACTCGATGGACCTTGTCTTCGACGGTCGAGACATCAATCATGGAGTCCCAAGAAAGATCATGAAATGGGGAGTGCTTAATCATGAAGAAAGGGTATGTCCCAAAATCCTCATGGAATGCAAAAAGGACTCTGATTGCTTAGCTGAGTGTATCTGTCTCGAGCATGGATATTGTGGCTAA ATGTGGCAAAACGAGATGACACAAATGGGCATTGCCAGCCAGATGCAATACACATTCTTATCATTCAAGTTTCAACGTCAAATTGGGAGCAAAATCTCCTCTTTCTCTTCTATAAAATGGTACCCAAACAGACAAGAGGTACTAACAAAAAGACCTGAAATGGGTAGCATGAAGATTGTCGCGGTGGCTCTAATCGCAATTTTGCTGGTAGCAACGTTGTCGTCGGCTGCCTATGCCATCGACGACGACTCGATGGACCTTGTCTTCGACGGTCGAGACATCAATCATGGAGTCCCAAGAAAGATCATGAAATGGGGAGTGCTTAATCATGAAGAAAGGGTATGTCCCAAAATCCTCATGGAATGCAAAAAGGACTCTGATTGCTTAGCTGAGTGTATCTGTCTCGAGCATGGATATTGTGGCTAA MWQNEMTQMGIASQMQYTFLSFKFQRQIGSKISSFSSIKWYPNRQEVLTKRPEMGSMKIVAVALIAILLVATLSSAAYAIDDDSMDLVFDGRDINHGVPRKIMKWGVLNHEERVCPKILMECKKDSDCLAECICLEHGYCG
BLAST of Carg19685 vs. NCBI nr
Match: XP_022922566.1 (probable polygalacturonase At3g15720 [Cucurbita moschata]) HSP 1 Score: 157.1 bits (396), Expect = 4.3e-35 Identity = 78/80 (97.50%), Postives = 79/80 (98.75%), Query Frame = 0
BLAST of Carg19685 vs. NCBI nr
Match: XP_023552846.1 (probable polygalacturonase At3g15720 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 146.0 bits (367), Expect = 9.8e-32 Identity = 74/78 (94.87%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of Carg19685 vs. NCBI nr
Match: KGN52764.1 (hypothetical protein Csa_4G000835 [Cucumis sativus]) HSP 1 Score: 89.7 bits (221), Expect = 8.4e-15 Identity = 54/98 (55.10%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Carg19685 vs. NCBI nr
Match: XP_011654312.1 (PREDICTED: trypsin inhibitor 1-like [Cucumis sativus]) HSP 1 Score: 82.4 bits (202), Expect = 1.3e-12 Identity = 42/68 (61.76%), Postives = 49/68 (72.06%), Query Frame = 0
BLAST of Carg19685 vs. NCBI nr
Match: P10293.1 (RecName: Full=Trypsin inhibitor 3; AltName: Full=CPTI-III; AltName: Full=Trypsin inhibitor III; Contains: RecName: Full=Trypsin inhibitor 2; AltName: Full=CPTI-II; AltName: Full=Trypsin inhibitor II) HSP 1 Score: 77.4 bits (189), Expect = 4.3e-11 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Carg19685 vs. Swiss-Prot
Match: sp|P10293|ITR3_CUCPE (Trypsin inhibitor 3 OS=Cucurbita pepo OX=3663 PE=1 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 1.4e-13 Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Carg19685 vs. Swiss-Prot
Match: sp|P07853|ITR4_CUCMA (Trypsin inhibitor 4 OS=Cucurbita maxima OX=3661 PE=1 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 1.2e-12 Identity = 29/32 (90.62%), Postives = 32/32 (100.00%), Query Frame = 0
BLAST of Carg19685 vs. Swiss-Prot
Match: sp|P01074|ITR1_CUCMA (Trypsin inhibitor 1 OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 5.0e-11 Identity = 27/29 (93.10%), Postives = 29/29 (100.00%), Query Frame = 0
BLAST of Carg19685 vs. Swiss-Prot
Match: sp|P83398|ITR7_CYCPE (Trypsin inhibitor 7 OS=Cyclanthera pedata OX=198836 PE=1 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 2.1e-09 Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 0
BLAST of Carg19685 vs. Swiss-Prot
Match: sp|P83397|ITR6_CYCPE (Trypsin inhibitor 6 OS=Cyclanthera pedata OX=198836 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.7e-09 Identity = 24/29 (82.76%), Postives = 28/29 (96.55%), Query Frame = 0
BLAST of Carg19685 vs. TrEMBL
Match: tr|A0A0A0KV23|A0A0A0KV23_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000835 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 5.5e-15 Identity = 54/98 (55.10%), Postives = 68/98 (69.39%), Query Frame = 0
BLAST of Carg19685 vs. TrEMBL
Match: tr|J3R9Z5|J3R9Z5_MOMCO (Two inhibitor peptide topologies 3 OS=Momordica cochinchinensis OX=3674 GN=TIPTOP3 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 5.0e-08 Identity = 41/91 (45.05%), Postives = 52/91 (57.14%), Query Frame = 0
BLAST of Carg19685 vs. TrEMBL
Match: tr|A0A0A7HIA9|A0A0A7HIA9_9ROSI (TIPRE5 (Fragment) OS=Momordica friesiorum OX=703365 GN=TIPRE5 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 6.6e-08 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of Carg19685 vs. TrEMBL
Match: tr|A0A0A7HG47|A0A0A7HG47_9ROSI (TIPRE1 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE1 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.5e-07 Identity = 37/86 (43.02%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of Carg19685 vs. TrEMBL
Match: tr|A0A0A7HF33|A0A0A7HF33_9ROSI (TIPRE2 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE2 PE=3 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 1.5e-07 Identity = 37/86 (43.02%), Postives = 52/86 (60.47%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |