CsGy4G000290 (gene) Cucumber (Gy14) v2
The following sequences are available for this feature:
Legend: exonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCCGACGGAGTGAATGAGTACTCACAAAATATTGGAAAGGATACTGCACCCGGCTGCCCTCGAATCCTTATGAAGTGTAAAACCGACAGCGATTGCTACCCTGGCTGTACTTGCAAACCGATGGGCTATTGTGGTTGA ATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCCGACGGAGTGAATGAGTACTCACAAAATATTGGAAAGGATACTGCACCCGGCTGCCCTCGAATCCTTATGAAGTGTAAAACCGACAGCGATTGCTACCCTGGCTGTACTTGCAAACCGATGGGCTATTGTGGTTGA ATGGAGTGGAAAAAAATTGCTTTAGTTGCAATGATGGGGATGTTGCTTATGGCTACTTTTACAGAGTCAGTCGGTTTGGGCGTGGATGAGGAGATCATTCAATTAGTTTCCGACGGAGTGAATGAGTACTCACAAAATATTGGAAAGGATACTGCACCCGGCTGCCCTCGAATCCTTATGAAGTGTAAAACCGACAGCGATTGCTACCCTGGCTGTACTTGCAAACCGATGGGCTATTGTGGTTGA MEWKKIALVAMMGMLLMATFTESVGLGVDEEIIQLVSDGVNEYSQNIGKDTAPGCPRILMKCKTDSDCYPGCTCKPMGYCG
BLAST of CsGy4G000290 vs. NCBI nr
Match: KGN52761.1 (Trypsin inhibitor 1 [Cucumis sativus]) HSP 1 Score: 171.8 bits (434), Expect = 9.6e-40 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of CsGy4G000290 vs. NCBI nr
Match: XP_023552845.1 (uncharacterized protein LOC111810370 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 97.8 bits (242), Expect = 1.8e-17 Identity = 46/81 (56.79%), Postives = 62/81 (76.54%), Query Frame = 0
BLAST of CsGy4G000290 vs. NCBI nr
Match: XP_022984819.1 (trypsin inhibitor 1-like [Cucurbita maxima]) HSP 1 Score: 96.7 bits (239), Expect = 3.9e-17 Identity = 46/81 (56.79%), Postives = 61/81 (75.31%), Query Frame = 0
BLAST of CsGy4G000290 vs. NCBI nr
Match: Q43667.1 (RecName: Full=Trypsin inhibitor 1; AltName: Full=TTII; AltName: Full=Trypsin inhibitor I; Flags: Precursor >CAA57704.1 Trichosanthes trypsin inhibitor-I [Trichosanthes kirilowii]) HSP 1 Score: 72.0 bits (175), Expect = 1.0e-09 Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CsGy4G000290 vs. NCBI nr
Match: KGN52760.1 (hypothetical protein Csa_4G000805 [Cucumis sativus]) HSP 1 Score: 64.7 bits (156), Expect = 1.7e-07 Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsGy4G000290 vs. Swiss-Prot
Match: sp|Q43667|ITR1_TRIKI (Trypsin inhibitor 1 OS=Trichosanthes kirilowii OX=3677 PE=3 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 3.4e-12 Identity = 36/66 (54.55%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CsGy4G000290 vs. Swiss-Prot
Match: sp|P34950|ITR5_LUFAE (Trypsin inhibitor 5 OS=Luffa aegyptiaca OX=3670 PE=1 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.3e-08 Identity = 32/66 (48.48%), Postives = 39/66 (59.09%), Query Frame = 0
BLAST of CsGy4G000290 vs. Swiss-Prot
Match: sp|P84452|ITR5_SECED (Trypsin inhibitor 5 OS=Sechium edule OX=184140 PE=1 SV=1) HSP 1 Score: 56.6 bits (135), Expect = 1.5e-07 Identity = 20/27 (74.07%), Postives = 24/27 (88.89%), Query Frame = 0
BLAST of CsGy4G000290 vs. Swiss-Prot
Match: sp|P12071|ITR2_ECBEL (Trypsin inhibitor 2 OS=Ecballium elaterium OX=3679 PE=1 SV=2) HSP 1 Score: 53.5 bits (127), Expect = 1.2e-06 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 0
BLAST of CsGy4G000290 vs. Swiss-Prot
Match: sp|P11968|ITR2_BRYDI (Trypsin inhibitor 2 OS=Bryonia dioica OX=3652 PE=1 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.6e-06 Identity = 20/28 (71.43%), Postives = 22/28 (78.57%), Query Frame = 0
BLAST of CsGy4G000290 vs. TrEMBL
Match: tr|A0A0A0KY34|A0A0A0KY34_CUCSA (Trypsin inhibitor 1 OS=Cucumis sativus OX=3659 GN=Csa_4G000810 PE=3 SV=1) HSP 1 Score: 171.8 bits (434), Expect = 6.4e-40 Identity = 81/81 (100.00%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of CsGy4G000290 vs. TrEMBL
Match: tr|A0A0A0KT01|A0A0A0KT01_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000805 PE=3 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 1.1e-07 Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsGy4G000290 vs. TrEMBL
Match: tr|J3R2I9|J3R2I9_MOMCO (Two inhibitor peptide topologies 2 OS=Momordica cochinchinensis OX=3674 GN=TIPTOP2 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.0e-05 Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsGy4G000290 vs. TrEMBL
Match: tr|J3RCD6|J3RCD6_MOMCO (Two inhibitor peptide topologies 1 OS=Momordica cochinchinensis OX=3674 GN=TIPTOP1 PE=2 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.0e-05 Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsGy4G000290 vs. TrEMBL
Match: tr|A0A0A0KV23|A0A0A0KV23_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000835 PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 1.0e-05 Identity = 38/98 (38.78%), Postives = 53/98 (54.08%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber Gy14 genome (v2)
Date Performed: 2018-09-25
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|