ClCG09G019600 (gene) Watermelon (Charleston Gray)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA MASLVAATATTSTATASDPPLYFDEKWKMSKKESLTRSTRPSSFPIMKNSSHRRCSFTRKCARLVKEQRARFYIMRRCVTMLICWHDYTDS
BLAST of ClCG09G019600 vs. TrEMBL
Match: A0A0A0KUB0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G517730 PE=4 SV=1) HSP 1 Score: 166.4 bits (420), Expect = 1.6e-38 Identity = 80/93 (86.02%), Postives = 83/93 (89.25%), Query Frame = 1
BLAST of ClCG09G019600 vs. TrEMBL
Match: M5X652_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024599mg PE=4 SV=1) HSP 1 Score: 133.3 bits (334), Expect = 1.5e-28 Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
BLAST of ClCG09G019600 vs. TrEMBL
Match: B9T005_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0040480 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.1e-26 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 1
BLAST of ClCG09G019600 vs. TrEMBL
Match: B9HMJ7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s05800g PE=4 SV=2) HSP 1 Score: 124.4 bits (311), Expect = 7.1e-26 Identity = 59/84 (70.24%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of ClCG09G019600 vs. TrEMBL
Match: B9HTG9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s20930g PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 9.3e-26 Identity = 61/84 (72.62%), Postives = 71/84 (84.52%), Query Frame = 1
BLAST of ClCG09G019600 vs. TAIR10
Match: AT2G39705.1 (AT2G39705.1 ROTUNDIFOLIA like 8) HSP 1 Score: 92.4 bits (228), Expect = 1.5e-19 Identity = 51/88 (57.95%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of ClCG09G019600 vs. TAIR10
Match: AT3G55515.1 (AT3G55515.1 ROTUNDIFOLIA like 7) HSP 1 Score: 70.1 bits (170), Expect = 8.0e-13 Identity = 34/64 (53.12%), Postives = 40/64 (62.50%), Query Frame = 1
BLAST of ClCG09G019600 vs. TAIR10
Match: AT2G29125.1 (AT2G29125.1 ROTUNDIFOLIA like 2) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 35/88 (39.77%), Postives = 45/88 (51.14%), Query Frame = 1
BLAST of ClCG09G019600 vs. TAIR10
Match: AT5G59510.1 (AT5G59510.1 ROTUNDIFOLIA like 5) HSP 1 Score: 62.4 bits (150), Expect = 1.7e-10 Identity = 34/92 (36.96%), Postives = 48/92 (52.17%), Query Frame = 1
BLAST of ClCG09G019600 vs. TAIR10
Match: AT1G07490.1 (AT1G07490.1 ROTUNDIFOLIA like 3) HSP 1 Score: 61.2 bits (147), Expect = 3.7e-10 Identity = 36/94 (38.30%), Postives = 52/94 (55.32%), Query Frame = 1
BLAST of ClCG09G019600 vs. NCBI nr
Match: gi|778703484|ref|XP_011655374.1| (PREDICTED: uncharacterized protein LOC105435519 [Cucumis sativus]) HSP 1 Score: 166.4 bits (420), Expect = 2.3e-38 Identity = 80/93 (86.02%), Postives = 83/93 (89.25%), Query Frame = 1
BLAST of ClCG09G019600 vs. NCBI nr
Match: gi|596037259|ref|XP_007219762.1| (hypothetical protein PRUPE_ppa024599mg [Prunus persica]) HSP 1 Score: 133.3 bits (334), Expect = 2.2e-28 Identity = 68/97 (70.10%), Postives = 81/97 (83.51%), Query Frame = 1
BLAST of ClCG09G019600 vs. NCBI nr
Match: gi|694352127|ref|XP_009357749.1| (PREDICTED: uncharacterized protein LOC103948440 [Pyrus x bretschneideri]) HSP 1 Score: 130.2 bits (326), Expect = 1.9e-27 Identity = 67/95 (70.53%), Postives = 79/95 (83.16%), Query Frame = 1
BLAST of ClCG09G019600 vs. NCBI nr
Match: gi|223528804|gb|EEF30810.1| (conserved hypothetical protein [Ricinus communis]) HSP 1 Score: 127.1 bits (318), Expect = 1.6e-26 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 1
BLAST of ClCG09G019600 vs. NCBI nr
Match: gi|566182563|ref|XP_002311177.2| (hypothetical protein POPTR_0008s05800g [Populus trichocarpa]) HSP 1 Score: 124.4 bits (311), Expect = 1.0e-25 Identity = 59/84 (70.24%), Postives = 69/84 (82.14%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon (Charleston Gray)
Date Performed: 2016-09-28
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|