Cla97C09G181050 (gene) Watermelon (97103) v2
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA ATGGCTTCCCTGGTCGCTGCAACTGCAACTACTTCAACTGCTACTGCCAGTGATCCTCCTCTTTACTTCGATGAGAAATGGAAGATGTCCAAGAAAGAAAGCTTAACCAGATCAACCCGCCCTTCTTCTTTCCCTATCATGAAAAATTCCTCTCATAGAAGATGTTCTTTCACAAGGAAGTGCGCTAGATTGGTCAAAGAACAGAGAGCTCGATTCTACATCATGAGGCGATGCGTCACCATGCTCATCTGTTGGCACGATTACACCGATTCTTGA MASLVAATATTSTATASDPPLYFDEKWKMSKKESLTRSTRPSSFPIMKNSSHRRCSFTRKCARLVKEQRARFYIMRRCVTMLICWHDYTDS
BLAST of Cla97C09G181050 vs. NCBI nr
Match: XP_011655374.1 (PREDICTED: uncharacterized protein LOC105435519 [Cucumis sativus] >KGN51326.1 hypothetical protein Csa_5G517730 [Cucumis sativus]) HSP 1 Score: 136.7 bits (343), Expect = 3.9e-29 Identity = 71/93 (76.34%), Postives = 73/93 (78.49%), Query Frame = 0
BLAST of Cla97C09G181050 vs. NCBI nr
Match: XP_022938385.1 (uncharacterized protein LOC111444651 [Cucurbita moschata]) HSP 1 Score: 129.0 bits (323), Expect = 8.0e-27 Identity = 68/93 (73.12%), Postives = 73/93 (78.49%), Query Frame = 0
BLAST of Cla97C09G181050 vs. NCBI nr
Match: OAY46117.1 (hypothetical protein MANES_07G117800 [Manihot esculenta]) HSP 1 Score: 128.3 bits (321), Expect = 1.4e-26 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Cla97C09G181050 vs. NCBI nr
Match: OAY38611.1 (hypothetical protein MANES_10G028700 [Manihot esculenta]) HSP 1 Score: 124.4 bits (311), Expect = 2.0e-25 Identity = 63/84 (75.00%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Cla97C09G181050 vs. NCBI nr
Match: XP_022139156.1 (uncharacterized protein LOC111010130 [Momordica charantia]) HSP 1 Score: 122.9 bits (307), Expect = 5.8e-25 Identity = 56/80 (70.00%), Postives = 69/80 (86.25%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TrEMBL
Match: tr|A0A0A0KUB0|A0A0A0KUB0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G517730 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.5e-29 Identity = 71/93 (76.34%), Postives = 73/93 (78.49%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TrEMBL
Match: tr|A0A2C9VKL2|A0A2C9VKL2_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_07G117800 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 9.1e-27 Identity = 61/82 (74.39%), Postives = 70/82 (85.37%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TrEMBL
Match: tr|A0A2C9V2X7|A0A2C9V2X7_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_10G028700 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 1.3e-25 Identity = 63/84 (75.00%), Postives = 71/84 (84.52%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TrEMBL
Match: tr|B9T005|B9T005_RICCO (Uncharacterized protein OS=Ricinus communis OX=3988 GN=RCOM_0040480 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 8.5e-25 Identity = 63/87 (72.41%), Postives = 72/87 (82.76%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TrEMBL
Match: tr|V7B6F3|V7B6F3_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris OX=3885 GN=PHAVU_008G191700g PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 5.5e-24 Identity = 58/80 (72.50%), Postives = 67/80 (83.75%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TAIR10
Match: AT2G39705.1 (ROTUNDIFOLIA like 8) HSP 1 Score: 87.0 bits (214), Expect = 6.3e-18 Identity = 51/88 (57.95%), Postives = 62/88 (70.45%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TAIR10
Match: AT3G55515.1 (ROTUNDIFOLIA like 7) HSP 1 Score: 66.6 bits (161), Expect = 8.9e-12 Identity = 34/64 (53.12%), Postives = 42/64 (65.62%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TAIR10
Match: AT2G36985.1 (DVL family protein) HSP 1 Score: 55.1 bits (131), Expect = 2.7e-08 Identity = 20/32 (62.50%), Postives = 29/32 (90.62%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TAIR10
Match: AT5G59510.1 (ROTUNDIFOLIA like 5) HSP 1 Score: 54.3 bits (129), Expect = 4.6e-08 Identity = 23/47 (48.94%), Postives = 32/47 (68.09%), Query Frame = 0
BLAST of Cla97C09G181050 vs. TAIR10
Match: AT3G14362.1 (ROTUNDIFOLIA like 10) HSP 1 Score: 53.5 bits (127), Expect = 7.8e-08 Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of watermelon 97103 v2
Date Performed: 2019-05-12
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|