Cp4.1LG01g23760 (gene) Cucurbita pepo (Zucchini)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCTCTGGTCGGTGCTTCTGCAACTGCTTCAAATCCTACTGCCAACGATCCCCCTTTCTACTTCGACGAGAAATGGAAGATGTCCAAGAAAGAAGGCTTAACCAGAACCCGCTCCTCCTCTTTCCCTCTCATGAAAAACTCCTCTCTTAGAAGGTGTTCGTTCACTAGAAAGTGCGCCAGATTGGTCAAAGAACAGAGGGCTCGATTCTACATCATGAGACGATGCGTCACCATGCTCATCTGCTGGAACGATTACACCGATTCTTGA ATGGCTGCTCTGGTCGGTGCTTCTGCAACTGCTTCAAATCCTACTGCCAACGATCCCCCTTTCTACTTCGACGAGAAATGGAAGATGTCCAAGAAAGAAGGCTTAACCAGAACCCGCTCCTCCTCTTTCCCTCTCATGAAAAACTCCTCTCTTAGAAGGTGTTCGTTCACTAGAAAGTGCGCCAGATTGGTCAAAGAACAGAGGGCTCGATTCTACATCATGAGACGATGCGTCACCATGCTCATCTGCTGGAACGATTACACCGATTCTTGA ATGGCTGCTCTGGTCGGTGCTTCTGCAACTGCTTCAAATCCTACTGCCAACGATCCCCCTTTCTACTTCGACGAGAAATGGAAGATGTCCAAGAAAGAAGGCTTAACCAGAACCCGCTCCTCCTCTTTCCCTCTCATGAAAAACTCCTCTCTTAGAAGGTGTTCGTTCACTAGAAAGTGCGCCAGATTGGTCAAAGAACAGAGGGCTCGATTCTACATCATGAGACGATGCGTCACCATGCTCATCTGCTGGAACGATTACACCGATTCTTGA MAALVGASATASNPTANDPPFYFDEKWKMSKKEGLTRTRSSSFPLMKNSSLRRCSFTRKCARLVKEQRARFYIMRRCVTMLICWNDYTDS
BLAST of Cp4.1LG01g23760 vs. TrEMBL
Match: A0A0A0KUB0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G517730 PE=4 SV=1) HSP 1 Score: 150.6 bits (379), Expect = 9.1e-34 Identity = 76/93 (81.72%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TrEMBL
Match: B9HTG9_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0010s20930g PE=4 SV=1) HSP 1 Score: 126.7 bits (317), Expect = 1.4e-26 Identity = 59/81 (72.84%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TrEMBL
Match: B9HMJ7_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0008s05800g PE=4 SV=2) HSP 1 Score: 125.6 bits (314), Expect = 3.1e-26 Identity = 59/81 (72.84%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TrEMBL
Match: M5X652_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa024599mg PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.1e-26 Identity = 63/93 (67.74%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TrEMBL
Match: V7B6F3_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_008G191700g PE=4 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 5.4e-26 Identity = 58/79 (73.42%), Postives = 66/79 (83.54%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TAIR10
Match: AT2G39705.1 (AT2G39705.1 ROTUNDIFOLIA like 8) HSP 1 Score: 92.4 bits (228), Expect = 1.5e-19 Identity = 47/74 (63.51%), Postives = 55/74 (74.32%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TAIR10
Match: AT3G55515.1 (AT3G55515.1 ROTUNDIFOLIA like 7) HSP 1 Score: 65.1 bits (157), Expect = 2.6e-11 Identity = 37/70 (52.86%), Postives = 43/70 (61.43%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TAIR10
Match: AT2G29125.1 (AT2G29125.1 ROTUNDIFOLIA like 2) HSP 1 Score: 55.8 bits (133), Expect = 1.6e-08 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TAIR10
Match: AT1G53708.1 (AT1G53708.1 ROTUNDIFOLIA like 9) HSP 1 Score: 52.8 bits (125), Expect = 1.3e-07 Identity = 23/30 (76.67%), Postives = 25/30 (83.33%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. TAIR10
Match: AT5G59510.1 (AT5G59510.1 ROTUNDIFOLIA like 5) HSP 1 Score: 52.4 bits (124), Expect = 1.7e-07 Identity = 27/77 (35.06%), Postives = 45/77 (58.44%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. NCBI nr
Match: gi|778703484|ref|XP_011655374.1| (PREDICTED: uncharacterized protein LOC105435519 [Cucumis sativus]) HSP 1 Score: 150.6 bits (379), Expect = 1.3e-33 Identity = 76/93 (81.72%), Postives = 82/93 (88.17%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. NCBI nr
Match: gi|224112731|ref|XP_002316275.1| (hypothetical protein POPTR_0010s20930g [Populus trichocarpa]) HSP 1 Score: 126.7 bits (317), Expect = 2.0e-26 Identity = 59/81 (72.84%), Postives = 70/81 (86.42%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. NCBI nr
Match: gi|596037259|ref|XP_007219762.1| (hypothetical protein PRUPE_ppa024599mg [Prunus persica]) HSP 1 Score: 125.6 bits (314), Expect = 4.5e-26 Identity = 63/93 (67.74%), Postives = 78/93 (83.87%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. NCBI nr
Match: gi|566182563|ref|XP_002311177.2| (hypothetical protein POPTR_0008s05800g [Populus trichocarpa]) HSP 1 Score: 125.6 bits (314), Expect = 4.5e-26 Identity = 59/81 (72.84%), Postives = 68/81 (83.95%), Query Frame = 1
BLAST of Cp4.1LG01g23760 vs. NCBI nr
Match: gi|802547175|ref|XP_012088921.1| (PREDICTED: uncharacterized protein LOC105647439 [Jatropha curcas]) HSP 1 Score: 124.8 bits (312), Expect = 7.7e-26 Identity = 62/87 (71.26%), Postives = 72/87 (82.76%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Cucurbita pepo
Date Performed: 2017-12-02
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|