Carg25683 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTACTTGCTGCCGCATCTTCACTCTGGATGGGCCGTTGATCAGGCAATCCTCACCGAAGAAGAACGCCTTGTGGTTATTCGTTTCGGTCATGACTGGGACGAGACCTGTATGCAGGTCTTTCTCTTTCCCTACTTCACAATTATTGTTGTTCATCATCAGATTTAATCATAATCCTTTTGTGTATATCTCTCCCTACCCCCTGTTTCTTCTTTTTGCTTCTACTGAACTGATATTTGTTCTGTTTCGGCTTTTAATTTCATAATATAAGACTCATTTTTTTTCAGTTCTTGGAGTCTATCAAGTCTCAGTCGGTCAAGGATTTTTCTTTTCTATTTTTGGGTTTTCTTTAATCTGGGCTTGATTTTTGTATGCATGCTTGCCTCAATTGACCAATTTTCTGAGTTTTATGTGCAATTTTTAGAATTGGTTGCTCGATCTTCTCTGTTATCATCATCTGTTCTGTTGCAATTCTGCTCCTCGCTTTCTATAATCATGCTTTCCTATGTATTTGAGCACATCAGTCCTATTACGCACCTGAAATGAAGTTATTAAACGACTTGCCTATTGATCTTTAATAATCCAGTCTTTGATTGTTGTTGCTGTATGCACGAGGTTTTCCATGCTAGCGGGATGATCAAAGTTTGAGTTCATGGGCCATCTAGACTCTTTTTTGGTGTATGATTTGTTTAGAGTCTTTTCCCCCTTGTTTTTGTTGCACGGAGCCACAATCCTTCCATCGTGAATGTTTAAAGTCGTGAAGATTTTTTCACATAATTTGTTTGGTTTACTCTACGTGATCATCTTTATAGTATTTTGAGATGTTATTATCTGATTGATATGTTTTTAATATAGATGGATGAGGTGTTGGCCTCAGTTGCTGAGACGATCAAGAACTTTGCAGTAATATACCTTGTGGATATCACTGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCTTCCACTGTCATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGTAACAACAATAAGATAAACTGGGCCCTCAAGGATAAGCAAGAGTTCATCAATATCATTGAAACAGTCTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCTAAGGACTATTCAACCAAATATCGCTACTAA ATGTCGTACTTGCTGCCGCATCTTCACTCTGGATGGGCCGTTGATCAGGCAATCCTCACCGAAGAAGAACGCCTTGTGGTTATTCGTTTCGGTCATGACTGGGACGAGACCTGTATGCAGATGGATGAGGTGTTGGCCTCAGTTGCTGAGACGATCAAGAACTTTGCAGTAATATACCTTGTGGATATCACTGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCTTCCACTGTCATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGTAACAACAATAAGATAAACTGGGCCCTCAAGGATAAGCAAGAGTTCATCAATATCATTGAAACAGTCTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCTAAGGACTATTCAACCAAATATCGCTACTAA ATGTCGTACTTGCTGCCGCATCTTCACTCTGGATGGGCCGTTGATCAGGCAATCCTCACCGAAGAAGAACGCCTTGTGGTTATTCGTTTCGGTCATGACTGGGACGAGACCTGTATGCAGATGGATGAGGTGTTGGCCTCAGTTGCTGAGACGATCAAGAACTTTGCAGTAATATACCTTGTGGATATCACTGAGGTTCCTGATTTCAACACAATGTACGAGCTGTATGATCCTTCCACTGTCATGTTCTTCTTTAGGAACAAGCACATAATGATTGATCTTGGTACTGGTAACAACAATAAGATAAACTGGGCCCTCAAGGATAAGCAAGAGTTCATCAATATCATTGAAACAGTCTATCGTGGAGCAAGGAAAGGACGTGGTTTAGTCATTGCACCTAAGGACTATTCAACCAAATATCGCTACTAA MSYLLPHLHSGWAVDQAILTEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFINIIETVYRGARKGRGLVIAPKDYSTKYRY
BLAST of Carg25683 vs. NCBI nr
Match: XP_022942612.1 (thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022942613.1 thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022988010.1 thioredoxin-like protein YLS8 [Cucurbita maxima] >XP_023532721.1 thioredoxin-like protein YLS8 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 296.2 bits (757), Expect = 5.9e-77 Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Carg25683 vs. NCBI nr
Match: XP_016177040.1 (thioredoxin-like protein YLS8 [Arachis ipaensis] >XP_020966784.1 thioredoxin-like protein YLS8 [Arachis ipaensis] >XP_025677001.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025677002.1 thioredoxin-like protein YLS8 [Arachis hypogaea]) HSP 1 Score: 294.3 bits (752), Expect = 2.3e-76 Identity = 141/142 (99.30%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. NCBI nr
Match: XP_004148041.1 (PREDICTED: thioredoxin-like protein YLS8 [Cucumis sativus] >XP_004497782.1 PREDICTED: thioredoxin-like protein YLS8 [Cicer arietinum] >XP_006288859.1 thioredoxin-like protein YLS8 [Capsella rubella] >XP_006399318.1 thioredoxin-like protein YLS8 [Eutrema salsugineum] >XP_008457801.1 PREDICTED: thioredoxin-like protein YLS8 [Cucumis melo] >XP_010452811.1 PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] >XP_010491455.1 PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] >XP_012459864.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium raimondii] >XP_015894288.1 thioredoxin-like protein YLS8 [Ziziphus jujuba] >XP_015961428.1 thioredoxin-like protein YLS8 isoform X1 [Arachis duranensis] >XP_015961429.1 thioredoxin-like protein YLS8 isoform X1 [Arachis duranensis] >XP_016198827.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198828.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198829.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198830.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016198831.1 thioredoxin-like protein YLS8 isoform X1 [Arachis ipaensis] >XP_016734252.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium hirsutum] >XP_016734292.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium hirsutum] >XP_017612852.1 PREDICTED: thioredoxin-like protein YLS8 [Gossypium arboreum] >XP_019420159.1 PREDICTED: thioredoxin-like protein YLS8 [Lupinus angustifolius] >XP_019439280.1 PREDICTED: thioredoxin-like protein YLS8 [Lupinus angustifolius] >XP_021632944.1 thioredoxin-like protein YLS8 [Manihot esculenta] >XP_021674120.1 thioredoxin-like protein YLS8 [Hevea brasiliensis] >XP_021674917.1 thioredoxin-like protein YLS8 [Hevea brasiliensis] >XP_022139323.1 thioredoxin-like protein YLS8 isoform X1 [Momordica charantia] >XP_022153368.1 thioredoxin-like protein YLS8 [Momordica charantia] >XP_022153369.1 thioredoxin-like protein YLS8 [Momordica charantia] >XP_022927978.1 thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022927979.1 thioredoxin-like protein YLS8 [Cucurbita moschata] >XP_022971679.1 thioredoxin-like protein YLS8 [Cucurbita maxima] >XP_022971680.1 thioredoxin-like protein YLS8 [Cucurbita maxima] >XP_023513106.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_023513107.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_023513108.1 thioredoxin-like protein YLS8 isoform X1 [Cucurbita pepo subsp. pepo] >XP_024007091.1 thioredoxin-like protein YLS8 [Eutrema salsugineum] >XP_025695902.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025695903.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649101.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649102.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649103.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >XP_025649104.1 thioredoxin-like protein YLS8 [Arachis hypogaea] >ADV04065.1 mitosis protein YLS8 [Hevea brasiliensis] >AGH25793.1 YLS8 [Gossypium hirsutum] >EOA21757.1 hypothetical protein CARUB_v10002214mg [Capsella rubella] >ESQ40771.1 hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum] >KGN62024.1 hypothetical protein Csa_2G287060 [Cucumis sativus] >KHG03038.1 Thioredoxin-like protein 4A [Gossypium arboreum] >OAY33298.1 hypothetical protein MANES_13G084100 [Manihot esculenta] >OIV95198.1 hypothetical protein TanjilG_21588 [Lupinus angustifolius] >OIW14294.1 hypothetical protein TanjilG_21434 [Lupinus angustifolius] >OVA18434.1 mRNA splicing factor [Macleaya cordata]) HSP 1 Score: 292.4 bits (747), Expect = 8.6e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. NCBI nr
Match: KJB77370.1 (hypothetical protein B456_012G134400 [Gossypium raimondii]) HSP 1 Score: 292.4 bits (747), Expect = 8.6e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. NCBI nr
Match: GAU42866.1 (hypothetical protein TSUD_13340 [Trifolium subterraneum]) HSP 1 Score: 292.4 bits (747), Expect = 8.6e-76 Identity = 139/142 (97.89%), Postives = 142/142 (100.00%), Query Frame = 0
BLAST of Carg25683 vs. TAIR10
Match: AT5G08290.1 (mRNA splicing factor, thioredoxin-like U5 snRNP) HSP 1 Score: 291.2 bits (744), Expect = 3.5e-79 Identity = 139/142 (97.89%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. TAIR10
Match: AT3G24730.1 (mRNA splicing factor, thioredoxin-like U5 snRNP) HSP 1 Score: 92.8 bits (229), Expect = 1.8e-19 Identity = 51/137 (37.23%), Postives = 78/137 (56.93%), Query Frame = 0
BLAST of Carg25683 vs. Swiss-Prot
Match: sp|Q9FE62|YLS8_ARATH (Thioredoxin-like protein YLS8 OS=Arabidopsis thaliana OX=3702 GN=YLS8 PE=2 SV=1) HSP 1 Score: 291.2 bits (744), Expect = 6.2e-78 Identity = 139/142 (97.89%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. Swiss-Prot
Match: sp|P83876|TXN4A_HUMAN (Thioredoxin-like protein 4A OS=Homo sapiens OX=9606 GN=TXNL4A PE=1 SV=1) HSP 1 Score: 266.5 bits (680), Expect = 1.6e-70 Identity = 121/142 (85.21%), Postives = 135/142 (95.07%), Query Frame = 0
BLAST of Carg25683 vs. Swiss-Prot
Match: sp|P83877|TXN4A_MOUSE (Thioredoxin-like protein 4A OS=Mus musculus OX=10090 GN=Txnl4a PE=1 SV=1) HSP 1 Score: 266.5 bits (680), Expect = 1.6e-70 Identity = 121/142 (85.21%), Postives = 135/142 (95.07%), Query Frame = 0
BLAST of Carg25683 vs. Swiss-Prot
Match: sp|P87215|DIMI_SCHPO (Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dim1 PE=1 SV=1) HSP 1 Score: 235.0 bits (598), Expect = 5.3e-61 Identity = 108/142 (76.06%), Postives = 126/142 (88.73%), Query Frame = 0
BLAST of Carg25683 vs. Swiss-Prot
Match: sp|Q75BD8|DIB1_ASHGO (Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DIB1 PE=3 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 2.9e-51 Identity = 93/138 (67.39%), Postives = 113/138 (81.88%), Query Frame = 0
BLAST of Carg25683 vs. TrEMBL
Match: tr|S4U0X2|S4U0X2_GOSHI (thioredoxin-like protein YLS8 OS=Gossypium hirsutum OX=3635 GN=LOC107944993 PE=2 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 5.7e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. TrEMBL
Match: tr|A0A2P2M121|A0A2P2M121_RHIMU (Mitosis protein YLS8 OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 5.7e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. TrEMBL
Match: tr|A0A1J3EC65|A0A1J3EC65_NOCCA (Thioredoxin-like protein YLS8 OS=Noccaea caerulescens OX=107243 GN=LC_TR17093_c0_g1_i1_g.58856 PE=4 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 5.7e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. TrEMBL
Match: tr|A0A1J3DF14|A0A1J3DF14_NOCCA (Thioredoxin-like protein YLS8 (Fragment) OS=Noccaea caerulescens OX=107243 GN=GA_TR21189_c0_g1_i1_g.70234 PE=4 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 5.7e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
BLAST of Carg25683 vs. TrEMBL
Match: tr|A0A1J3IZG5|A0A1J3IZG5_NOCCA (Thioredoxin-like protein YLS8 (Fragment) OS=Noccaea caerulescens OX=107243 GN=MP_TR24166_c0_g1_i1_g.70258 PE=4 SV=1) HSP 1 Score: 292.4 bits (747), Expect = 5.7e-76 Identity = 140/142 (98.59%), Postives = 141/142 (99.30%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|