Carg24638 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTATGTTTCAAACTCGTTCTTTATTTGATTTCTTCTCAATAATTGTGTTTTCACATGTCTTTTACAATTTCGATAGGCAAATTCAGCATCAGGAATGGCAGTTCACGACGACTGCAAGCTAAAGTTTTTGGATCTTAAGGCTAAAAGAAAGTTCAGATTCATCGTGTTCAAGATCGATGAGAATATCCAACAGGTGACGGTCGAGAGAGTCGGTGGTCACGATGAAACCTACAACAACTTCCTCGCAGCCATCCCTGCTAATGAATGTCGTTACGCTGTCTATGATTTCGATTTCACAACCGACGAGAATTGCCAAAAGAGCAAGATCTTTTTTATTGCCTGGTATTATCCCGACATATTTATCGTACTATTTAATTTACTAACTTACGAACCTTTTCTTTTTTCCTTAAATTTTTATAATTTGTTTATGTAGGTCACCCGACTCGTCGAAAATAAGAAGTAAAATGTTGTATGCAAGCTCGAGGGATAGATTCAAGAGAGAATTGGATGGAATTCAAGTTGAATTACAGGCAACAGATCCCAGTGAGATGAGCATTGATATCATTAAAGCAAGAGCTATCTGA ATGGCAAATTCAGCATCAGGAATGGCAGTTCACGACGACTGCAAGCTAAAGTTTTTGGATCTTAAGGCTAAAAGAAAGTTCAGATTCATCGTGTTCAAGATCGATGAGAATATCCAACAGGTGACGGTCGAGAGAGTCGGTGGTCACGATGAAACCTACAACAACTTCCTCGCAGCCATCCCTGCTAATGAATGTCGTTACGCTGTCTATGATTTCGATTTCACAACCGACGAGAATTGCCAAAAGAGCAAGATCTTTTTTATTGCCTGGTCACCCGACTCGTCGAAAATAAGAAGTAAAATGTTGTATGCAAGCTCGAGGGATAGATTCAAGAGAGAATTGGATGGAATTCAAGTTGAATTACAGGCAACAGATCCCAGTGAGATGAGCATTGATATCATTAAAGCAAGAGCTATCTGA ATGGCAAATTCAGCATCAGGAATGGCAGTTCACGACGACTGCAAGCTAAAGTTTTTGGATCTTAAGGCTAAAAGAAAGTTCAGATTCATCGTGTTCAAGATCGATGAGAATATCCAACAGGTGACGGTCGAGAGAGTCGGTGGTCACGATGAAACCTACAACAACTTCCTCGCAGCCATCCCTGCTAATGAATGTCGTTACGCTGTCTATGATTTCGATTTCACAACCGACGAGAATTGCCAAAAGAGCAAGATCTTTTTTATTGCCTGGTCACCCGACTCGTCGAAAATAAGAAGTAAAATGTTGTATGCAAGCTCGAGGGATAGATTCAAGAGAGAATTGGATGGAATTCAAGTTGAATTACAGGCAACAGATCCCAGTGAGATGAGCATTGATATCATTAAAGCAAGAGCTATCTGA MANSASGMAVHDDCKLKFLDLKAKRKFRFIVFKIDENIQQVTVERVGGHDETYNNFLAAIPANECRYAVYDFDFTTDENCQKSKIFFIAWSPDSSKIRSKMLYASSRDRFKRELDGIQVELQATDPSEMSIDIIKARAI
BLAST of Carg24638 vs. NCBI nr
Match: XP_022974602.1 (actin-depolymerizing factor 7-like isoform X2 [Cucurbita maxima]) HSP 1 Score: 276.2 bits (705), Expect = 6.2e-71 Identity = 137/139 (98.56%), Postives = 138/139 (99.28%), Query Frame = 0
BLAST of Carg24638 vs. NCBI nr
Match: XP_022974601.1 (actin-depolymerizing factor 7-like isoform X1 [Cucurbita maxima]) HSP 1 Score: 274.2 bits (700), Expect = 2.4e-70 Identity = 136/138 (98.55%), Postives = 137/138 (99.28%), Query Frame = 0
BLAST of Carg24638 vs. NCBI nr
Match: XP_022944628.1 (actin-depolymerizing factor 6-like [Cucurbita moschata]) HSP 1 Score: 273.9 bits (699), Expect = 3.1e-70 Identity = 136/138 (98.55%), Postives = 136/138 (98.55%), Query Frame = 0
BLAST of Carg24638 vs. NCBI nr
Match: XP_023540370.1 (actin-depolymerizing factor-like [Cucurbita pepo subsp. pepo] >XP_023540371.1 actin-depolymerizing factor-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 263.8 bits (673), Expect = 3.2e-67 Identity = 129/132 (97.73%), Postives = 131/132 (99.24%), Query Frame = 0
BLAST of Carg24638 vs. NCBI nr
Match: XP_022974603.1 (actin-depolymerizing factor-like isoform X3 [Cucurbita maxima]) HSP 1 Score: 263.5 bits (672), Expect = 4.2e-67 Identity = 130/132 (98.48%), Postives = 131/132 (99.24%), Query Frame = 0
BLAST of Carg24638 vs. TAIR10
Match: AT4G00680.1 (actin depolymerizing factor 8) HSP 1 Score: 224.2 bits (570), Expect = 5.1e-59 Identity = 104/137 (75.91%), Postives = 127/137 (92.70%), Query Frame = 0
BLAST of Carg24638 vs. TAIR10
Match: AT1G01750.1 (actin depolymerizing factor 11) HSP 1 Score: 223.8 bits (569), Expect = 6.6e-59 Identity = 106/137 (77.37%), Postives = 123/137 (89.78%), Query Frame = 0
BLAST of Carg24638 vs. TAIR10
Match: AT4G25590.1 (actin depolymerizing factor 7) HSP 1 Score: 223.8 bits (569), Expect = 6.6e-59 Identity = 107/139 (76.98%), Postives = 127/139 (91.37%), Query Frame = 0
BLAST of Carg24638 vs. TAIR10
Match: AT5G52360.1 (actin depolymerizing factor 10) HSP 1 Score: 213.0 bits (541), Expect = 1.2e-55 Identity = 104/139 (74.82%), Postives = 122/139 (87.77%), Query Frame = 0
BLAST of Carg24638 vs. TAIR10
Match: AT5G59890.1 (actin depolymerizing factor 4) HSP 1 Score: 213.0 bits (541), Expect = 1.2e-55 Identity = 100/137 (72.99%), Postives = 121/137 (88.32%), Query Frame = 0
BLAST of Carg24638 vs. Swiss-Prot
Match: sp|P30175|ADF_LILLO (Actin-depolymerizing factor OS=Lilium longiflorum OX=4690 PE=2 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 2.2e-59 Identity = 108/138 (78.26%), Postives = 128/138 (92.75%), Query Frame = 0
BLAST of Carg24638 vs. Swiss-Prot
Match: sp|Q7XSN9|ADF6_ORYSJ (Actin-depolymerizing factor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=ADF6 PE=2 SV=2) HSP 1 Score: 226.9 bits (577), Expect = 1.4e-58 Identity = 108/139 (77.70%), Postives = 127/139 (91.37%), Query Frame = 0
BLAST of Carg24638 vs. Swiss-Prot
Match: sp|Q6EUH7|ADF1_ORYSJ (Actin-depolymerizing factor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=ADF1 PE=2 SV=1) HSP 1 Score: 226.1 bits (575), Expect = 2.4e-58 Identity = 106/139 (76.26%), Postives = 129/139 (92.81%), Query Frame = 0
BLAST of Carg24638 vs. Swiss-Prot
Match: sp|Q570Y6|ADF8_ARATH (Actin-depolymerizing factor 8 OS=Arabidopsis thaliana OX=3702 GN=ADF8 PE=2 SV=2) HSP 1 Score: 224.2 bits (570), Expect = 9.2e-58 Identity = 104/137 (75.91%), Postives = 127/137 (92.70%), Query Frame = 0
BLAST of Carg24638 vs. Swiss-Prot
Match: sp|Q9LQ81|ADF10_ARATH (Actin-depolymerizing factor 10 OS=Arabidopsis thaliana OX=3702 GN=ADF10 PE=2 SV=1) HSP 1 Score: 223.8 bits (569), Expect = 1.2e-57 Identity = 106/137 (77.37%), Postives = 123/137 (89.78%), Query Frame = 0
BLAST of Carg24638 vs. TrEMBL
Match: tr|A0A0A0L6A2|A0A0A0L6A2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G122480 PE=3 SV=1) HSP 1 Score: 245.7 bits (626), Expect = 5.9e-62 Identity = 117/139 (84.17%), Postives = 135/139 (97.12%), Query Frame = 0
BLAST of Carg24638 vs. TrEMBL
Match: tr|A0A2I0I7L3|A0A2I0I7L3_PUNGR (Uncharacterized protein OS=Punica granatum OX=22663 GN=CRG98_039640 PE=3 SV=1) HSP 1 Score: 242.7 bits (618), Expect = 5.0e-61 Identity = 114/139 (82.01%), Postives = 133/139 (95.68%), Query Frame = 0
BLAST of Carg24638 vs. TrEMBL
Match: tr|A0A1U7ZEK8|A0A1U7ZEK8_NELNU (actin-depolymerizing factor OS=Nelumbo nucifera OX=4432 GN=LOC104592249 PE=3 SV=1) HSP 1 Score: 241.9 bits (616), Expect = 8.6e-61 Identity = 117/139 (84.17%), Postives = 130/139 (93.53%), Query Frame = 0
BLAST of Carg24638 vs. TrEMBL
Match: tr|M5XE35|M5XE35_PRUPE (Uncharacterized protein OS=Prunus persica OX=3760 GN=PRUPE_2G165300 PE=3 SV=1) HSP 1 Score: 240.7 bits (613), Expect = 1.9e-60 Identity = 115/139 (82.73%), Postives = 132/139 (94.96%), Query Frame = 0
BLAST of Carg24638 vs. TrEMBL
Match: tr|A0A2P6SH25|A0A2P6SH25_ROSCH (Putative ADF/Cofilin, ADF-H/Gelsolin-like domain-containing protein OS=Rosa chinensis OX=74649 GN=RchiOBHm_Chr1g0354101 PE=3 SV=1) HSP 1 Score: 240.0 bits (611), Expect = 3.3e-60 Identity = 115/139 (82.73%), Postives = 130/139 (93.53%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: None |