Carg19697 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGAATCAGTTCGGCAGTTTAGTGGAATCCATAAAATCCAAGGTGAAGGCGCTGAAGAAGTCGAAGAAGCCGTATATAAAGATGGACAAAAGCTCCAGCGTCAAGGTTGAGATCCGTAGCCGAAAAGCTCGATTGTTGATCGATAAAACTATGAAGGTCGCCGATCGTCCTGGCAAGCGCACTGTTTCTTAG ATGGCGAATCAGTTCGGCAGTTTAGTGGAATCCATAAAATCCAAGGTGAAGGCGCTGAAGAAGTCGAAGAAGCCGTATATAAAGATGGACAAAAGCTCCAGCGTCAAGGTTGAGATCCGTAGCCGAAAAGCTCGATTGTTGATCGATAAAACTATGAAGGTCGCCGATCGTCCTGGCAAGCGCACTGTTTCTTAG ATGGCGAATCAGTTCGGCAGTTTAGTGGAATCCATAAAATCCAAGGTGAAGGCGCTGAAGAAGTCGAAGAAGCCGTATATAAAGATGGACAAAAGCTCCAGCGTCAAGGTTGAGATCCGTAGCCGAAAAGCTCGATTGTTGATCGATAAAACTATGAAGGTCGCCGATCGTCCTGGCAAGCGCACTGTTTCTTAG MANQFGSLVESIKSKVKALKKSKKPYIKMDKSSSVKVEIRSRKARLLIDKTMKVADRPGKRTVS
BLAST of Carg19697 vs. NCBI nr
Match: XP_022922964.1 (uncharacterized protein LOC111430789 [Cucurbita moschata] >XP_023553058.1 uncharacterized protein LOC111810569 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 115.9 bits (289), Expect = 4.9e-23 Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Carg19697 vs. NCBI nr
Match: XP_022984885.1 (uncharacterized protein LOC111483028 [Cucurbita maxima]) HSP 1 Score: 114.8 bits (286), Expect = 1.1e-22 Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 0
BLAST of Carg19697 vs. NCBI nr
Match: XP_008454414.1 (PREDICTED: uncharacterized protein LOC103494825 [Cucumis melo] >ADN33813.1 hypothetical protein [Cucumis melo subsp. melo]) HSP 1 Score: 110.9 bits (276), Expect = 1.6e-21 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Carg19697 vs. NCBI nr
Match: XP_004150261.1 (PREDICTED: uncharacterized protein LOC101219359 [Cucumis sativus] >KGN52743.1 hypothetical protein Csa_4G000640 [Cucumis sativus]) HSP 1 Score: 110.5 bits (275), Expect = 2.1e-21 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Carg19697 vs. NCBI nr
Match: XP_022149139.1 (uncharacterized protein LOC111017632 [Momordica charantia] >XP_022149140.1 uncharacterized protein LOC111017632 [Momordica charantia]) HSP 1 Score: 110.5 bits (275), Expect = 2.1e-21 Identity = 59/64 (92.19%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Carg19697 vs. TAIR10
Match: AT3G19660.1 (unknown protein) HSP 1 Score: 78.2 bits (191), Expect = 2.1e-15 Identity = 44/63 (69.84%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Carg19697 vs. TrEMBL
Match: tr|A0A1S3BZS5|A0A1S3BZS5_CUCME (uncharacterized protein LOC103494825 OS=Cucumis melo OX=3656 GN=LOC103494825 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-21 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Carg19697 vs. TrEMBL
Match: tr|E5GBH1|E5GBH1_CUCME (Uncharacterized protein OS=Cucumis melo subsp. melo OX=412675 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 1.1e-21 Identity = 60/64 (93.75%), Postives = 63/64 (98.44%), Query Frame = 0
BLAST of Carg19697 vs. TrEMBL
Match: tr|A0A0A0KT27|A0A0A0KT27_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G000640 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.4e-21 Identity = 60/64 (93.75%), Postives = 62/64 (96.88%), Query Frame = 0
BLAST of Carg19697 vs. TrEMBL
Match: tr|A0A2C9V4E8|A0A2C9V4E8_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_10G086400 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 3.7e-19 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
BLAST of Carg19697 vs. TrEMBL
Match: tr|A0A2C9VLA0|A0A2C9VLA0_MANES (Uncharacterized protein OS=Manihot esculenta OX=3983 GN=MANES_07G057600 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.1e-18 Identity = 55/64 (85.94%), Postives = 61/64 (95.31%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|