Carg12887 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCATAACTTCCACAGCTCAACTTCCTCCGGTGCTCGACACCGACGGTCAACCTCTACGACGTGGTGTTGAGTACTACATCAAGCCTGCAATCACTGACGTTGCAGGTAATCTCACCCTAAAAAGTCGTAGCAATGCTCCTTGCCCACTCTACGTTGGTCAAGAACCAATTGCTTCGACAAATATCGGTCTTCCGGTCACCTTCACTCCCATCGTGGCGGGCGAAGATATAATTGAAGAAAGTATGGGTTTCAATGTTGTGTTTCAAGCGTCGTCAACGTGCATAACATCAACGCAATGGAGAGTGGATGAGATGGAGTCTGCAACAGGGAGGAGGTTCGTGGGGGTTGGGAACGATAACGGTCCGACTGGGATCTTTAGGATCGACAGGAACAATGGAGTTTACAATATAGTATGGTGCCCTGAGATGGTAGGGAGGCCAAGGTGTGGAAGTGCTGGGATTTTGGTGGAGGATGGAGTGAGGCTGCTGGCTTTGGATGGCAATGCGTTTCCTTTTGAGTTTGTCAAAGCTTGA ATGGCCATAACTTCCACAGCTCAACTTCCTCCGGTGCTCGACACCGACGGTCAACCTCTACGACGTGGTGTTGAGTACTACATCAAGCCTGCAATCACTGACGTTGCAGGTAATCTCACCCTAAAAAGTCGTAGCAATGCTCCTTGCCCACTCTACGTTGGTCAAGAACCAATTGCTTCGACAAATATCGGTCTTCCGGTCACCTTCACTCCCATCGTGGCGGGCGAAGATATAATTGAAGAAAGTATGGGTTTCAATGTTGTGTTTCAAGCGTCGTCAACGTGCATAACATCAACGCAATGGAGAGTGGATGAGATGGAGTCTGCAACAGGGAGGAGGTTCGTGGGGGTTGGGAACGATAACGGTCCGACTGGGATCTTTAGGATCGACAGGAACAATGGAGTTTACAATATAGTATGGTGCCCTGAGATGGTAGGGAGGCCAAGGTGTGGAAGTGCTGGGATTTTGGTGGAGGATGGAGTGAGGCTGCTGGCTTTGGATGGCAATGCGTTTCCTTTTGAGTTTGTCAAAGCTTGA ATGGCCATAACTTCCACAGCTCAACTTCCTCCGGTGCTCGACACCGACGGTCAACCTCTACGACGTGGTGTTGAGTACTACATCAAGCCTGCAATCACTGACGTTGCAGGTAATCTCACCCTAAAAAGTCGTAGCAATGCTCCTTGCCCACTCTACGTTGGTCAAGAACCAATTGCTTCGACAAATATCGGTCTTCCGGTCACCTTCACTCCCATCGTGGCGGGCGAAGATATAATTGAAGAAAGTATGGGTTTCAATGTTGTGTTTCAAGCGTCGTCAACGTGCATAACATCAACGCAATGGAGAGTGGATGAGATGGAGTCTGCAACAGGGAGGAGGTTCGTGGGGGTTGGGAACGATAACGGTCCGACTGGGATCTTTAGGATCGACAGGAACAATGGAGTTTACAATATAGTATGGTGCCCTGAGATGGTAGGGAGGCCAAGGTGTGGAAGTGCTGGGATTTTGGTGGAGGATGGAGTGAGGCTGCTGGCTTTGGATGGCAATGCGTTTCCTTTTGAGTTTGTCAAAGCTTGA MAITSTAQLPPVLDTDGQPLRRGVEYYIKPAITDVAGNLTLKSRSNAPCPLYVGQEPIASTNIGLPVTFTPIVAGEDIIEESMGFNVVFQASSTCITSTQWRVDEMESATGRRFVGVGNDNGPTGIFRIDRNNGVYNIVWCPEMVGRPRCGSAGILVEDGVRLLALDGNAFPFEFVKA
BLAST of Carg12887 vs. NCBI nr
Match: XP_022946294.1 (miraculin-like [Cucurbita moschata] >XP_022946295.1 miraculin-like [Cucurbita moschata]) HSP 1 Score: 367.9 bits (943), Expect = 2.0e-98 Identity = 178/178 (100.00%), Postives = 178/178 (100.00%), Query Frame = 0
BLAST of Carg12887 vs. NCBI nr
Match: XP_023545477.1 (miraculin-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 362.1 bits (928), Expect = 1.1e-96 Identity = 174/178 (97.75%), Postives = 176/178 (98.88%), Query Frame = 0
BLAST of Carg12887 vs. NCBI nr
Match: XP_022999136.1 (miraculin-like [Cucurbita maxima]) HSP 1 Score: 361.7 bits (927), Expect = 1.4e-96 Identity = 173/178 (97.19%), Postives = 177/178 (99.44%), Query Frame = 0
BLAST of Carg12887 vs. NCBI nr
Match: XP_022150789.1 (miraculin-like [Momordica charantia]) HSP 1 Score: 299.7 bits (766), Expect = 6.7e-78 Identity = 148/180 (82.22%), Postives = 158/180 (87.78%), Query Frame = 0
BLAST of Carg12887 vs. NCBI nr
Match: XP_004139192.1 (PREDICTED: miraculin-like [Cucumis sativus]) HSP 1 Score: 299.3 bits (765), Expect = 8.8e-78 Identity = 139/178 (78.09%), Postives = 156/178 (87.64%), Query Frame = 0
BLAST of Carg12887 vs. TAIR10
Match: AT1G73325.1 (Kunitz family trypsin and protease inhibitor protein) HSP 1 Score: 69.3 bits (168), Expect = 2.7e-12 Identity = 51/174 (29.31%), Postives = 84/174 (48.28%), Query Frame = 0
BLAST of Carg12887 vs. Swiss-Prot
Match: sp|P13087|MIRA_SYNDU (Miraculin OS=Synsepalum dulcificum OX=3743 PE=1 SV=3) HSP 1 Score: 100.1 bits (248), Expect = 2.6e-20 Identity = 65/183 (35.52%), Postives = 91/183 (49.73%), Query Frame = 0
BLAST of Carg12887 vs. Swiss-Prot
Match: sp|P07596|IAAS_HORVU (Alpha-amylase/subtilisin inhibitor OS=Hordeum vulgare OX=4513 PE=1 SV=2) HSP 1 Score: 84.3 bits (207), Expect = 1.5e-15 Identity = 55/153 (35.95%), Postives = 76/153 (49.67%), Query Frame = 0
BLAST of Carg12887 vs. Swiss-Prot
Match: sp|P16347|IAAS_WHEAT (Endogenous alpha-amylase/subtilisin inhibitor OS=Triticum aestivum OX=4565 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 1.6e-14 Identity = 53/143 (37.06%), Postives = 71/143 (49.65%), Query Frame = 0
BLAST of Carg12887 vs. Swiss-Prot
Match: sp|P32765|ASP_THECC (21 kDa seed protein OS=Theobroma cacao OX=3641 GN=ASP PE=2 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 4.0e-13 Identity = 59/186 (31.72%), Postives = 88/186 (47.31%), Query Frame = 0
BLAST of Carg12887 vs. Swiss-Prot
Match: sp|P25272|KTI1_SOYBN (Kunitz-type trypsin inhibitor KTI1 OS=Glycine max OX=3847 GN=KTI1 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 1.3e-11 Identity = 50/170 (29.41%), Postives = 75/170 (44.12%), Query Frame = 0
BLAST of Carg12887 vs. TrEMBL
Match: tr|A0A0A0LIK2|A0A0A0LIK2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G021500 PE=4 SV=1) HSP 1 Score: 299.3 bits (765), Expect = 5.8e-78 Identity = 139/178 (78.09%), Postives = 156/178 (87.64%), Query Frame = 0
BLAST of Carg12887 vs. TrEMBL
Match: tr|A0A0A0LGB4|A0A0A0LGB4_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G021000 PE=4 SV=1) HSP 1 Score: 230.7 bits (587), Expect = 2.5e-57 Identity = 117/183 (63.93%), Postives = 134/183 (73.22%), Query Frame = 0
BLAST of Carg12887 vs. TrEMBL
Match: tr|A0A1S3C0M7|A0A1S3C0M7_CUCME (endogenous alpha-amylase/subtilisin inhibitor-like OS=Cucumis melo OX=3656 GN=LOC103495287 PE=4 SV=1) HSP 1 Score: 215.3 bits (547), Expect = 1.1e-52 Identity = 111/184 (60.33%), Postives = 127/184 (69.02%), Query Frame = 0
BLAST of Carg12887 vs. TrEMBL
Match: tr|B9N8J2|B9N8J2_POPTR (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_004G000400v3 PE=4 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 7.4e-49 Identity = 110/188 (58.51%), Postives = 120/188 (63.83%), Query Frame = 0
BLAST of Carg12887 vs. TrEMBL
Match: tr|E9NH21|E9NH21_POPNI (Kunitz-type trypsin inhibitor OS=Populus nigra OX=3691 PE=2 SV=1) HSP 1 Score: 202.6 bits (514), Expect = 7.4e-49 Identity = 110/188 (58.51%), Postives = 120/188 (63.83%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene:
|