Carg02860 (gene) Silver-seed gourd
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGCCAGAGCTCCCCAAGCTCCGAGGACTTTGCCGGAATCTTGTTGCTAGGATCGGCAGGAGTTGCCGACGGTACCATCACTCAACTGATTTCCGTTATGATCCTTCGAGCTATGCCCTTAATTTCGAGGACGAACAGGTTCGCGACGATGATGAGTATCCAATTAGGGATTTCGCTTCCAGATTGCCACCGTCGCCGCCGGCTTCTCAGAGATTTATGGCGGCAAAATGA ATGGCGCCAGAGCTCCCCAAGCTCCGAGGACTTTGCCGGAATCTTGTTGCTAGGATCGGCAGGAGTTGCCGACGGTACCATCACTCAACTGATTTCCGTTATGATCCTTCGAGCTATGCCCTTAATTTCGAGGACGAACAGGTTCGCGACGATGATGAGTATCCAATTAGGGATTTCGCTTCCAGATTGCCACCGTCGCCGCCGGCTTCTCAGAGATTTATGGCGGCAAAATGA ATGGCGCCAGAGCTCCCCAAGCTCCGAGGACTTTGCCGGAATCTTGTTGCTAGGATCGGCAGGAGTTGCCGACGGTACCATCACTCAACTGATTTCCGTTATGATCCTTCGAGCTATGCCCTTAATTTCGAGGACGAACAGGTTCGCGACGATGATGAGTATCCAATTAGGGATTTCGCTTCCAGATTGCCACCGTCGCCGCCGGCTTCTCAGAGATTTATGGCGGCAAAATGA MAPELPKLRGLCRNLVARIGRSCRRYHHSTDFRYDPSSYALNFEDEQVRDDDEYPIRDFASRLPPSPPASQRFMAAK
BLAST of Carg02860 vs. NCBI nr
Match: XP_023523424.1 (uncharacterized protein LOC111787637 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 134.0 bits (336), Expect = 2.1e-28 Identity = 64/77 (83.12%), Postives = 68/77 (88.31%), Query Frame = 0
BLAST of Carg02860 vs. NCBI nr
Match: XP_022940408.1 (uncharacterized protein LOC111446022 [Cucurbita moschata]) HSP 1 Score: 133.3 bits (334), Expect = 3.6e-28 Identity = 64/77 (83.12%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Carg02860 vs. NCBI nr
Match: XP_022981208.1 (uncharacterized protein LOC111480417 [Cucurbita maxima]) HSP 1 Score: 131.3 bits (329), Expect = 1.4e-27 Identity = 62/77 (80.52%), Postives = 67/77 (87.01%), Query Frame = 0
BLAST of Carg02860 vs. NCBI nr
Match: XP_022138148.1 (uncharacterized protein LOC111009386 [Momordica charantia]) HSP 1 Score: 115.5 bits (288), Expect = 7.8e-23 Identity = 57/76 (75.00%), Postives = 62/76 (81.58%), Query Frame = 0
BLAST of Carg02860 vs. NCBI nr
Match: XP_008452891.1 (PREDICTED: uncharacterized protein LOC103493778 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 8.6e-22 Identity = 55/75 (73.33%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of Carg02860 vs. TAIR10
Match: AT5G35090.1 (unknown protein) HSP 1 Score: 56.6 bits (135), Expect = 7.8e-09 Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 0
BLAST of Carg02860 vs. TAIR10
Match: AT5G11070.1 (unknown protein) HSP 1 Score: 48.5 bits (114), Expect = 2.1e-06 Identity = 32/81 (39.51%), Postives = 40/81 (49.38%), Query Frame = 0
BLAST of Carg02860 vs. TrEMBL
Match: tr|A0A1S3BVQ9|A0A1S3BVQ9_CUCME (uncharacterized protein LOC103493778 OS=Cucumis melo OX=3656 GN=LOC103493778 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 5.7e-22 Identity = 55/75 (73.33%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of Carg02860 vs. TrEMBL
Match: tr|A0A0A0L4E2|A0A0A0L4E2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G652740 PE=4 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.7e-21 Identity = 54/69 (78.26%), Postives = 60/69 (86.96%), Query Frame = 0
BLAST of Carg02860 vs. TrEMBL
Match: tr|W9RJD0|W9RJD0_9ROSA (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_008530 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.4e-15 Identity = 44/71 (61.97%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of Carg02860 vs. TrEMBL
Match: tr|A0A251URC9|A0A251URC9_HELAN (Uncharacterized protein OS=Helianthus annuus OX=4232 GN=HannXRQ_Chr05g0141561 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.9e-10 Identity = 39/72 (54.17%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Carg02860 vs. TrEMBL
Match: tr|A0A1U8AF97|A0A1U8AF97_NELNU (uncharacterized protein LOC104603387 OS=Nelumbo nucifera OX=4432 GN=LOC104603387 PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.9e-10 Identity = 38/69 (55.07%), Postives = 52/69 (75.36%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of silver-seed gourd
Date Performed: 2019-03-07
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |