Bhi05G000878 (gene) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCTGCCGCAGGGTAACCTCTAAAAACCATTACTCTTTAATTCCTCTCTTACTTCTGCTACACTTTCTCGAAATTCTTATATCCAAATCGAATGTATCTTACTTTTTCTTTCCGAGAAATTGATGTATCTCTCTTATTCTTTGTTTTCATCTCGCTTTCGCGCTTTGATTTGACTGATTTTTGGCTGTGATTCGTTGAATTTTGACGATTTCAGGTTATCCGCCGCAAGGATATCCTCCGAAGGACGCTTATCCACCGCAGGGCGGTTATGCTCCGGCGGGATATCCACCTCCCCCGGTGTACGGTCATCCTCCGCCGCAACATCAAAACCAAAAGGAAGAGGATGGATTCTTCAAACGCTG ATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCTGCCGCAGGGTTATCCGCCGCAAGGATATCCTCCGAAGGACGCTTATCCACCGCAGGGCGGTTATGCTCCGGCGGGATATCCACCTCCCCCGGTGTACGGTCATCCTCCGCCGCAACATCAAAACCAAAAGGAAGAGGATGGATTCTTCAAACGCTG ATGAGTTACTACAACCAGCCACCGCCTCCCGTCGGCGTTCCTCTGCCGCAGGGTTATCCGCCGCAAGGATATCCTCCGAAGGACGCTTATCCACCGCAGGGCGGTTATGCTCCGGCGGGATATCCACCTCCCCCGGTGTACGGTCATCCTCCGCCGCAACATCAAAACCAAAAGGAAGAGGATGGATTCTTCAAACGCTG MSYYNQPPPPVGVPLPQGYPPQGYPPKDAYPPQGGYAPAGYPPPPVYGHPPPQHQNQKEEDGFFKR Homology
BLAST of Bhi05G000878 vs. TAIR 10
Match: AT2G41420.1 (proline-rich family protein ) HSP 1 Score: 68.2 bits (165), Expect = 2.9e-12 Identity = 46/85 (54.12%), Postives = 49/85 (57.65%), Query Frame = 0
BLAST of Bhi05G000878 vs. TAIR 10
Match: AT3G49845.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: root; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 53.9 bits (128), Expect = 5.6e-08 Identity = 32/59 (54.24%), Postives = 35/59 (59.32%), Query Frame = 0
BLAST of Bhi05G000878 vs. TAIR 10
Match: AT5G67600.1 (unknown protein; LOCATED IN: plasma membrane; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G49845.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 53.1 bits (126), Expect = 9.6e-08 Identity = 36/71 (50.70%), Postives = 41/71 (57.75%), Query Frame = 0
BLAST of Bhi05G000878 vs. TAIR 10
Match: AT4G19200.1 (proline-rich family protein ) HSP 1 Score: 46.6 bits (109), Expect = 9.0e-06 Identity = 27/49 (55.10%), Postives = 28/49 (57.14%), Query Frame = 0
BLAST of Bhi05G000878 vs. TAIR 10
Match: AT5G17650.1 (glycine/proline-rich protein ) HSP 1 Score: 43.1 bits (100), Expect = 9.9e-05 Identity = 30/60 (50.00%), Postives = 32/60 (53.33%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy Swiss-Prot
Match: Q8S8M0 (Cysteine-rich and transmembrane domain-containing protein WIH2 OS=Arabidopsis thaliana OX=3702 GN=WIH2 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.1e-11 Identity = 46/85 (54.12%), Postives = 49/85 (57.65%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy Swiss-Prot
Match: Q9FJW3 (Cysteine-rich and transmembrane domain-containing protein WIH1 OS=Arabidopsis thaliana OX=3702 GN=WIH1 PE=2 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 1.4e-06 Identity = 36/71 (50.70%), Postives = 41/71 (57.75%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy Swiss-Prot
Match: P09241 (Rhodopsin OS=Enteroctopus dofleini OX=267067 GN=RHO PE=2 SV=1) HSP 1 Score: 52.8 bits (125), Expect = 1.8e-06 Identity = 31/48 (64.58%), Postives = 33/48 (68.75%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy Swiss-Prot
Match: P24639 (Annexin A7 OS=Dictyostelium discoideum OX=44689 GN=nxnA PE=1 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 9.7e-05 Identity = 31/52 (59.62%), Postives = 33/52 (63.46%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy Swiss-Prot
Match: P31356 (Rhodopsin OS=Todarodes pacificus OX=6637 GN=RHO PE=1 SV=2) HSP 1 Score: 46.6 bits (109), Expect = 1.3e-04 Identity = 30/44 (68.18%), Postives = 31/44 (70.45%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy TrEMBL
Match: A0A6J1I9Y5 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita maxima OX=3661 GN=LOC111470998 PE=4 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 5.5e-19 Identity = 55/72 (76.39%), Postives = 56/72 (77.78%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy TrEMBL
Match: A0A0A0K2W8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G070830 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 9.4e-19 Identity = 55/77 (71.43%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy TrEMBL
Match: A0A6J1GJV9 (cysteine-rich and transmembrane domain-containing protein WIH2-like OS=Cucurbita moschata OX=3662 GN=LOC111454944 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 4.7e-18 Identity = 54/76 (71.05%), Postives = 55/76 (72.37%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy TrEMBL
Match: A0A5A7SME1 (Cysteine-rich and transmembrane domain-containing protein A-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G001290 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 9.7e-16 Identity = 53/78 (67.95%), Postives = 55/78 (70.51%), Query Frame = 0
BLAST of Bhi05G000878 vs. ExPASy TrEMBL
Match: A0A1S3BZZ2 (cysteine-rich and transmembrane domain-containing protein A-like OS=Cucumis melo OX=3656 GN=LOC103495315 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 9.7e-16 Identity = 53/78 (67.95%), Postives = 55/78 (70.51%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|