Cmc08g0222971 (gene) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCATGGAATTAGGAGAACACAATATTAGAGTGAATTGTATTTGTCCTGGACTGTTTAAATCTGAAATTACAAAAGATCTTATGGAAAAAGATTGGATTAAGAATGTAGCTAGGAGAATGAACCCTTTAGGAACATTTGGAACTTCAAATCCAGCATTAACGACGACCATTCGATACTTGGTGCACGACTCTTCTAAATACGTCTCCGGTAACATTTTTATAGTCGATTCAGGAAACTCATTACTTGGTGTTCCAATCTTTTCATCCCTTTGA ATGGCCATGGAATTAGGAGAACACAATATTAGAGTGAATTGTATTTGTCCTGGACTGTTTAAATCTGAAATTACAAAAGATCTTATGGAAAAAGATTGGATTAAGAATGTAGCTAGGAGAATGAACCCTTTAGGAACATTTGGAACTTCAAATCCAGCATTAACGACGACCATTCGATACTTGGTGCACGACTCTTCTAAATACGTCTCCGGTAACATTTTTATAGTCGATTCAGGAAACTCATTACTTGGTGTTCCAATCTTTTCATCCCTTTGA ATGGCCATGGAATTAGGAGAACACAATATTAGAGTGAATTGTATTTGTCCTGGACTGTTTAAATCTGAAATTACAAAAGATCTTATGGAAAAAGATTGGATTAAGAATGTAGCTAGGAGAATGAACCCTTTAGGAACATTTGGAACTTCAAATCCAGCATTAACGACGACCATTCGATACTTGGTGCACGACTCTTCTAAATACGTCTCCGGTAACATTTTTATAGTCGATTCAGGAAACTCATTACTTGGTGTTCCAATCTTTTCATCCCTTTGA MAMELGEHNIRVNCICPGLFKSEITKDLMEKDWIKNVARRMNPLGTFGTSNPALTTTIRYLVHDSSKYVSGNIFIVDSGNSLLGVPIFSSL Homology
BLAST of Cmc08g0222971 vs. NCBI nr
Match: TYK27821.1 (3-oxoacyl-(acyl-carrier-protein) reductase FabG-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 189.1 bits (479), Expect = 1.7e-44 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc08g0222971 vs. NCBI nr
Match: KAA0025891.1 (3-oxoacyl-(acyl-carrier-protein) reductase FabG-like isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 189.1 bits (479), Expect = 1.7e-44 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc08g0222971 vs. NCBI nr
Match: XP_011653852.2 (uncharacterized protein LOC101207345 [Cucumis sativus] >KAE8649670.1 hypothetical protein Csa_011948 [Cucumis sativus]) HSP 1 Score: 169.9 bits (429), Expect = 1.0e-38 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of Cmc08g0222971 vs. NCBI nr
Match: XP_031740575.1 (uncharacterized protein LOC101207105 [Cucumis sativus] >KAE8649668.1 hypothetical protein Csa_012368 [Cucumis sativus]) HSP 1 Score: 162.9 bits (411), Expect = 1.3e-36 Identity = 79/91 (86.81%), Postives = 84/91 (92.31%), Query Frame = 0
BLAST of Cmc08g0222971 vs. NCBI nr
Match: XP_038883585.1 (3-oxoacyl-[acyl-carrier-protein] reductase FabG-like [Benincasa hispida]) HSP 1 Score: 157.5 bits (397), Expect = 5.4e-35 Identity = 75/91 (82.42%), Postives = 80/91 (87.91%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy Swiss-Prot
Match: Q9PKF7 (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=fabG PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.8e-08 Identity = 29/82 (35.37%), Postives = 45/82 (54.88%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy Swiss-Prot
Match: P38004 (3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=fabG PE=3 SV=3) HSP 1 Score: 58.2 bits (139), Expect = 5.8e-08 Identity = 29/82 (35.37%), Postives = 44/82 (53.66%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy Swiss-Prot
Match: Q8N4T8 (3-oxoacyl-[acyl-carrier-protein] reductase OS=Homo sapiens OX=9606 GN=CBR4 PE=1 SV=3) HSP 1 Score: 52.8 bits (125), Expect = 2.4e-06 Identity = 28/83 (33.73%), Postives = 44/83 (53.01%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy Swiss-Prot
Match: Q6NUE2 (Carbonyl reductase family member 4 OS=Xenopus laevis OX=8355 GN=cbr4 PE=2 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.2e-06 Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy Swiss-Prot
Match: P9WGQ8 (Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0793 PE=3 SV=1) HSP 1 Score: 52.4 bits (124), Expect = 3.2e-06 Identity = 28/79 (35.44%), Postives = 44/79 (55.70%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy TrEMBL
Match: A0A5D3DVU8 (3-oxoacyl-(Acyl-carrier-protein) reductase FabG-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold749G00520 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 8.0e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy TrEMBL
Match: A0A5A7SNS1 (3-oxoacyl-(Acyl-carrier-protein) reductase FabG-like isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold34G001790 PE=4 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 8.0e-45 Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy TrEMBL
Match: A0A0A0KYF0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G429290 PE=4 SV=1) HSP 1 Score: 169.9 bits (429), Expect = 5.0e-39 Identity = 82/91 (90.11%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy TrEMBL
Match: A0A0A0L258 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G427280 PE=3 SV=1) HSP 1 Score: 162.9 bits (411), Expect = 6.2e-37 Identity = 79/91 (86.81%), Postives = 84/91 (92.31%), Query Frame = 0
BLAST of Cmc08g0222971 vs. ExPASy TrEMBL
Match: A0A1S4E0S1 (3-oxoacyl-[acyl-carrier-protein] reductase FabG-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103495898 PE=3 SV=1) HSP 1 Score: 151.4 bits (381), Expect = 1.9e-33 Identity = 71/75 (94.67%), Postives = 72/75 (96.00%), Query Frame = 0
BLAST of Cmc08g0222971 vs. TAIR 10
Match: AT3G55290.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 124.8 bits (312), Expect = 3.6e-29 Identity = 59/91 (64.84%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of Cmc08g0222971 vs. TAIR 10
Match: AT3G55290.2 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 124.8 bits (312), Expect = 3.6e-29 Identity = 59/91 (64.84%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of Cmc08g0222971 vs. TAIR 10
Match: AT3G55310.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 124.0 bits (310), Expect = 6.1e-29 Identity = 59/91 (64.84%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of Cmc08g0222971 vs. TAIR 10
Match: AT3G46170.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 121.7 bits (304), Expect = 3.0e-28 Identity = 57/91 (62.64%), Postives = 71/91 (78.02%), Query Frame = 0
BLAST of Cmc08g0222971 vs. TAIR 10
Match: AT2G17845.1 (NAD(P)-binding Rossmann-fold superfamily protein ) HSP 1 Score: 119.4 bits (298), Expect = 1.5e-27 Identity = 57/91 (62.64%), Postives = 71/91 (78.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|