![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lcy11g005300 (gene) Sponge gourd (P93075) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACGGCAGTCGCTGTGACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAATGGCTGCCCAATCGAGCTCGTCGAGCCAGAGATATTGCGCTTCAAGGCCTACGAACCCATCCTCCTCCTCGGTCGCCATCGTTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCGCAGATCTACGCCATCCGCCAGAGCATCGCCAAGGCTCTCGTCGCCTTCTACCAGAAGTACGTCGACGAACAAAGCAAGAAGGAGATCAAGGATATTCTCGTCCGCTACGATCGGACTTTGCTCGTCGCCGATCCCAGACGCTGTGAGCCGAAGAAATTTGGAGGTCGTGGAGCTCGTGCTAGGTTTCAGAAATCGTATCGTTGATCAAAGAGTTTTAGGCGTCCATCGCTTGGTAATGGTTATTTTTGGATTTTATGTTCTAATTATCTTCGGAGACGTGAAATTTTTTATCCATTTATGATTGTAGTATAAGAATTTTTGACCCGAGGCTTGAGTTTCTGATTACTATGATAATGCTTTTCTGAAACATCTGAGTTTTTCTTCCAATTGTTACTCGTTCGTGTTGAATACTGAACATCCCTCATTCCTACTCTGCATCTCTTGTGACATTATATTGCTGCTTTGAAGGTCTTTTAATATATTTCGTGCTCACCCCCAATAGAATTTTTGAATAG ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACGGCAGTCGCTGTGACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAATGGCTGCCCAATCGAGCTCGTCGAGCCAGAGATATTGCGCTTCAAGGCCTACGAACCCATCCTCCTCCTCGGTCGCCATCGTTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCGCAGATCTACGCCATCCGCCAGAGCATCGCCAAGGCTCTCGTCGCCTTCTACCAGAAGTACGTCGACGAACAAAGCAAGAAGGAGATCAAGGATATTCTCGTCCGCTACGATCGGACTTTGCTCGTCGCCGATCCCAGACGCTGTCTTTTAATATATTTCGTGCTCACCCCCAATAGAATTTTTGAATAG ATGGCGGCTCCAATCGAGTCTGTGCAATGCTTCGGCCGGAAGAAGACGGCAGTCGCTGTGACATACTGCAAGCGCGGCCGAGGCTTGATCAAGATCAATGGCTGCCCAATCGAGCTCGTCGAGCCAGAGATATTGCGCTTCAAGGCCTACGAACCCATCCTCCTCCTCGGTCGCCATCGTTTCTCCGGCGTCGACATGCGAATCAGAGTCAAAGGCGGAGGCCACACCTCGCAGATCTACGCCATCCGCCAGAGCATCGCCAAGGCTCTCGTCGCCTTCTACCAGAAGTACGTCGACGAACAAAGCAAGAAGGAGATCAAGGATATTCTCGTCCGCTACGATCGGACTTTGCTCGTCGCCGATCCCAGACGCTGTCTTTTAATATATTTCGTGCTCACCCCCAATAGAATTTTTGAATAG MAAPIESVQCFGRKKTAVAVTYCKRGRGLIKINGCPIELVEPEILRFKAYEPILLLGRHRFSGVDMRIRVKGGGHTSQIYAIRQSIAKALVAFYQKYVDEQSKKEIKDILVRYDRTLLVADPRRCLLIYFVLTPNRIFE Homology
BLAST of Lcy11g005300 vs. ExPASy Swiss-Prot
Match: P46293 (40S ribosomal protein S16 OS=Gossypium hirsutum OX=3635 GN=RPS16 PE=2 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 1.5e-60 Identity = 116/121 (95.87%), Postives = 118/121 (97.52%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy Swiss-Prot
Match: Q9SK22 (40S ribosomal protein S16-1 OS=Arabidopsis thaliana OX=3702 GN=RPS16A PE=2 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 7.1e-58 Identity = 107/120 (89.17%), Postives = 116/120 (96.67%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy Swiss-Prot
Match: Q42340 (40S ribosomal protein S16-3 OS=Arabidopsis thaliana OX=3702 GN=RPS16C PE=2 SV=1) HSP 1 Score: 224.2 bits (570), Expect = 9.3e-58 Identity = 106/120 (88.33%), Postives = 116/120 (96.67%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy Swiss-Prot
Match: O22647 (40S ribosomal protein S16 OS=Fritillaria agrestis OX=64177 GN=RPS16 PE=2 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 1.6e-57 Identity = 110/126 (87.30%), Postives = 120/126 (95.24%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy Swiss-Prot
Match: Q9M8X9 (40S ribosomal protein S16-2 OS=Arabidopsis thaliana OX=3702 GN=RPS16B PE=1 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 7.4e-55 Identity = 101/120 (84.17%), Postives = 113/120 (94.17%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy TrEMBL
Match: A0A6J1J781 (40S ribosomal protein S16-like OS=Cucurbita maxima OX=3661 GN=LOC111481879 PE=3 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 9.0e-64 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy TrEMBL
Match: A0A0A0L6F6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G202730 PE=3 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 9.0e-64 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy TrEMBL
Match: A0A1S3C210 (40S ribosomal protein S16 OS=Cucumis melo OX=3656 GN=LOC103496134 PE=3 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 9.0e-64 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy TrEMBL
Match: A0A6J1D637 (40S ribosomal protein S16 OS=Momordica charantia OX=3673 GN=LOC111017623 PE=3 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 9.0e-64 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. ExPASy TrEMBL
Match: A0A6J1FW85 (40S ribosomal protein S16-like OS=Cucurbita moschata OX=3662 GN=LOC111447898 PE=3 SV=1) HSP 1 Score: 252.7 bits (644), Expect = 9.0e-64 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. NCBI nr
Match: KAE8645860.1 (hypothetical protein Csa_017052 [Cucumis sativus]) HSP 1 Score: 252.7 bits (644), Expect = 1.9e-63 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. NCBI nr
Match: XP_004136973.1 (40S ribosomal protein S16 [Cucumis sativus] >XP_004140706.1 40S ribosomal protein S16 [Cucumis sativus] >XP_004149967.1 40S ribosomal protein S16 [Cucumis sativus] >XP_008454961.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456099.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_008456141.1 PREDICTED: 40S ribosomal protein S16 [Cucumis melo] >XP_022136342.1 40S ribosomal protein S16 [Momordica charantia] >XP_022149129.1 40S ribosomal protein S16 [Momordica charantia] >XP_022927908.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022943042.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022943043.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022952362.1 40S ribosomal protein S16-like [Cucurbita moschata] >XP_022972375.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_022983243.1 40S ribosomal protein S16-like [Cucurbita maxima] >XP_023535994.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >XP_023553863.1 40S ribosomal protein S16-like [Cucurbita pepo subsp. pepo] >XP_038877987.1 40S ribosomal protein S16 [Benincasa hispida] >XP_038880326.1 40S ribosomal protein S16 [Benincasa hispida] >XP_038886975.1 40S ribosomal protein S16 [Benincasa hispida] >KAA0031306.1 40S ribosomal protein S16 [Cucumis melo var. makuwa] >KAG6571970.1 40S ribosomal protein S16, partial [Cucurbita argyrosperma subsp. sororia] >KAG7011649.1 40S ribosomal protein S16, partial [Cucurbita argyrosperma subsp. argyrosperma] >KAA0037136.1 40S ribosomal protein S16 [Cucumis melo var. makuwa] >KAA0039084.1 40S ribosomal protein S16 [Cucumis melo var. makuwa]) HSP 1 Score: 252.7 bits (644), Expect = 1.9e-63 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. NCBI nr
Match: XP_022149351.1 (40S ribosomal protein S16-like [Momordica charantia]) HSP 1 Score: 252.3 bits (643), Expect = 2.4e-63 Identity = 124/125 (99.20%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. NCBI nr
Match: XP_022989000.1 (40S ribosomal protein S16-like [Cucurbita maxima]) HSP 1 Score: 251.5 bits (641), Expect = 4.2e-63 Identity = 124/125 (99.20%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. NCBI nr
Match: XP_040987369.1 (40S ribosomal protein S16 [Juglans microcarpa x Juglans regia]) HSP 1 Score: 251.1 bits (640), Expect = 5.4e-63 Identity = 123/125 (98.40%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Lcy11g005300 vs. TAIR 10
Match: AT5G18380.2 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 224.9 bits (572), Expect = 3.9e-59 Identity = 108/125 (86.40%), Postives = 118/125 (94.40%), Query Frame = 0
BLAST of Lcy11g005300 vs. TAIR 10
Match: AT2G09990.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 224.6 bits (571), Expect = 5.1e-59 Identity = 107/120 (89.17%), Postives = 116/120 (96.67%), Query Frame = 0
BLAST of Lcy11g005300 vs. TAIR 10
Match: AT5G18380.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 224.2 bits (570), Expect = 6.6e-59 Identity = 106/120 (88.33%), Postives = 116/120 (96.67%), Query Frame = 0
BLAST of Lcy11g005300 vs. TAIR 10
Match: AT3G04230.1 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 214.5 bits (545), Expect = 5.3e-56 Identity = 101/120 (84.17%), Postives = 113/120 (94.17%), Query Frame = 0
BLAST of Lcy11g005300 vs. TAIR 10
Match: AT5G18380.3 (Ribosomal protein S5 domain 2-like superfamily protein ) HSP 1 Score: 197.6 bits (501), Expect = 6.6e-51 Identity = 93/108 (86.11%), Postives = 104/108 (96.30%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Sponge gourd (P93075) v1
Date Performed: 2021-12-06 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|