![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MS017068.1 (mRNA) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GACAAATTTGATTGGGAAGTTCCGTGGCAAAAAGGAGATTCATTAGCTCGTTATTTAATCAGACTTGGTGAGATGACGAAATCTATAAAAATTATTCAACAAGTTTTGGAAGGAATTCCAGGAGGACCCTTTAAGAATTTAGAAATA GACAAATTTGATTGGGAAGTTCCGTGGCAAAAAGGAGATTCATTAGCTCGTTATTTAATCAGACTTGGTGAGATGACGAAATCTATAAAAATTATTCAACAAGTTTTGGAAGGAATTCCAGGAGGACCCTTTAAGAATTTAGAAATA GACAAATTTGATTGGGAAGTTCCGTGGCAAAAAGGAGATTCATTAGCTCGTTATTTAATCAGACTTGGTGAGATGACGAAATCTATAAAAATTATTCAACAAGTTTTGGAAGGAATTCCAGGAGGACCCTTTAAGAATTTAGAAATA DKFDWEVPWQKGDSLARYLIRLGEMTKSIKIIQQVLEGIPGGPFKNLEI Homology
BLAST of MS017068.1 vs. NCBI nr
Match: YP_009947871.1 (NADH-plastoquinone oxidoreductase subunit 7 [Cerbera manghas] >QOH92408.1 NADH-plastoquinone oxidoreductase subunit 7 [Cerbera manghas]) HSP 1 Score: 92.4 bits (228), Expect = 1.1e-15 Identity = 42/50 (84.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of MS017068.1 vs. NCBI nr
Match: QWK49745.1 (NADH-plastoquinone oxidoreductase subunit 7 [Ulmus lanceifolia] >QZQ52640.1 NADH dehydrogenase subunit H [Ulmus lanceifolia]) HSP 1 Score: 92.4 bits (228), Expect = 1.1e-15 Identity = 42/50 (84.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of MS017068.1 vs. NCBI nr
Match: YP_010122689.1 (NADH-plastoquinone oxidoreductase 49 kDa subunit [Acer circinatum] >QRF94427.1 NADH-plastoquinone oxidoreductase 49 kDa subunit [Acer circinatum]) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-15 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. NCBI nr
Match: YP_009108815.1 (NADH dehydrogenase 49 kDa subunit [Oncinotis tenuiloba] >AIW05659.1 NADH dehydrogenase 49 kDa subunit [Oncinotis tenuiloba]) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-15 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of MS017068.1 vs. NCBI nr
Match: AWH09201.1 (NADH dehydrogenase 49 kDa subunit [Asclepias schaffneri]) HSP 1 Score: 92.0 bits (227), Expect = 1.5e-15 Identity = 42/50 (84.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy Swiss-Prot
Match: Q09WW2 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Morus indica OX=248361 GN=ndhH PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 4.3e-18 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy Swiss-Prot
Match: Q09MC0 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Citrus sinensis OX=2711 GN=ndhH PE=3 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 5.7e-18 Identity = 40/50 (80.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy Swiss-Prot
Match: A1XG11 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nuphar advena OX=77108 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.3e-17 Identity = 40/49 (81.63%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy Swiss-Prot
Match: Q6EVZ4 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Nymphaea alba OX=34301 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.3e-17 Identity = 40/49 (81.63%), Postives = 46/49 (93.88%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy Swiss-Prot
Match: Q4VZL2 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhH PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 1.7e-17 Identity = 40/50 (80.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy TrEMBL
Match: A0A2H4NWD8 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Gustavia serrata OX=1421040 GN=ndhH PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 9.4e-16 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy TrEMBL
Match: A0A2H4NVT5 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Gustavia augusta OX=372736 GN=ndhH PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 9.4e-16 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy TrEMBL
Match: A0A6H0ESV9 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Trichosanthes nervifolia OX=1144448 GN=ndhH PE=3 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 9.4e-16 Identity = 42/50 (84.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy TrEMBL
Match: A0A2S1P286 (NAD(P)H-quinone oxidoreductase subunit H, chloroplastic OS=Asclepias welshii OX=660020 GN=ndhH PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. ExPASy TrEMBL
Match: A0A0S0ZHW1 (NdhH (Fragment) OS=Garrya flavescens OX=1197917 GN=ndhH PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.6e-15 Identity = 41/50 (82.00%), Postives = 47/50 (94.00%), Query Frame = 0
BLAST of MS017068.1 vs. TAIR 10
Match: ATCG01110.1 (NAD(P)H dehydrogenase subunit H ) HSP 1 Score: 85.1 bits (209), Expect = 1.7e-17 Identity = 37/49 (75.51%), Postives = 45/49 (91.84%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|