Pay0009459.1 (mRNA) Melon (Payzawat) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGTGCCAAGCTGCAACCCAGACAAGATTTCGGGCATTGAAACACGAGAATGGAATTGCAGGAAAACCAACAATTATAGTTAGAGTGATCGCATGCTTTCAACCTTTGCAGAGTTGTCAGGTTTGTCAACTCAGTTCTTGCCTTGTGATTTTGCTCGTTGATTCACAACCGGATTAGTTACACATTTATTTTGTTGGAATTGTTTTGTATTTTTTTCCCCTGGAAGTTGCCATGATGAAACTTTTGGCATTTTTTCTGTTCCAGGCTGAGTATTTTCGGCAATTGCTTAAGCCAGTCACGTAG ATGGTGTGCCAAGCTGCAACCCAGACAAGATTTCGGGCATTGAAACACGAGAATGGAATTGCAGGAAAACCAACAATTATAGTTAGAGTGATCGCATGCTTTCAACCTTTGCAGAGTTGTCAGGCTGAGTATTTTCGGCAATTGCTTAAGCCAGTCACGTAG ATGGTGTGCCAAGCTGCAACCCAGACAAGATTTCGGGCATTGAAACACGAGAATGGAATTGCAGGAAAACCAACAATTATAGTTAGAGTGATCGCATGCTTTCAACCTTTGCAGAGTTGTCAGGCTGAGTATTTTCGGCAATTGCTTAAGCCAGTCACGTAG MVCQAATQTRFRALKHENGIAGKPTIIVRVIACFQPLQSCQAEYFRQLLKPVT Homology
BLAST of Pay0009459.1 vs. ExPASy TrEMBL
Match: A0A1S4E402 (uncharacterized protein LOC103501164 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103501164 PE=4 SV=1) HSP 1 Score: 112.1 bits (279), Expect = 7.3e-22 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of Pay0009459.1 vs. ExPASy TrEMBL
Match: A0A0A0KVT2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G113180 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.7e-21 Identity = 51/53 (96.23%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of Pay0009459.1 vs. ExPASy TrEMBL
Match: W9R7U4 (Uncharacterized protein OS=Morus notabilis OX=981085 GN=L484_011398 PE=4 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 2.3e-20 Identity = 50/53 (94.34%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of Pay0009459.1 vs. ExPASy TrEMBL
Match: A0A0A0K458 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G066260 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 4.0e-20 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of Pay0009459.1 vs. ExPASy TrEMBL
Match: A0A1S4E0J3 (uncharacterized protein LOC103495379 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103495379 PE=4 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 4.0e-20 Identity = 49/53 (92.45%), Postives = 52/53 (98.11%), Query Frame = 0
BLAST of Pay0009459.1 vs. NCBI nr
Match: XP_016902954.1 (PREDICTED: uncharacterized protein LOC103501164 isoform X2 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 1.5e-21 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of Pay0009459.1 vs. NCBI nr
Match: KAG7014898.1 (hypothetical protein SDJN02_22529 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 110.9 bits (276), Expect = 3.3e-21 Identity = 52/53 (98.11%), Postives = 53/53 (100.00%), Query Frame = 0
BLAST of Pay0009459.1 vs. NCBI nr
Match: KAG7030896.1 (hypothetical protein SDJN02_04933, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 107.5 bits (267), Expect = 3.7e-20 Identity = 50/53 (94.34%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of Pay0009459.1 vs. NCBI nr
Match: KAG6576874.1 (Transcription factor basic helix-loop-helix 143, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 107.5 bits (267), Expect = 3.7e-20 Identity = 50/51 (98.04%), Postives = 51/51 (100.00%), Query Frame = 0
BLAST of Pay0009459.1 vs. NCBI nr
Match: EXB57311.1 (hypothetical protein L484_011398 [Morus notabilis]) HSP 1 Score: 107.1 bits (266), Expect = 4.8e-20 Identity = 50/53 (94.34%), Postives = 51/53 (96.23%), Query Frame = 0
BLAST of Pay0009459.1 vs. TAIR 10
Match: AT5G50011.1 (conserved peptide upstream open reading frame 37 ) HSP 1 Score: 89.7 bits (221), Expect = 7.4e-19 Identity = 43/53 (81.13%), Postives = 46/53 (86.79%), Query Frame = 0
BLAST of Pay0009459.1 vs. TAIR 10
Match: AT5G09461.1 (conserved peptide upstream open reading frame 43 ) HSP 1 Score: 80.1 bits (196), Expect = 5.9e-16 Identity = 37/54 (68.52%), Postives = 45/54 (83.33%), Query Frame = 0
BLAST of Pay0009459.1 vs. TAIR 10
Match: AT5G64341.1 (conserved peptide upstream open reading frame 40 ) HSP 1 Score: 79.0 bits (193), Expect = 1.3e-15 Identity = 35/53 (66.04%), Postives = 43/53 (81.13%), Query Frame = 0
BLAST of Pay0009459.1 vs. TAIR 10
Match: AT1G29951.1 (conserved peptide upstream open reading frame 35 ) HSP 1 Score: 40.4 bits (93), Expect = 5.2e-04 Identity = 18/23 (78.26%), Postives = 20/23 (86.96%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Payzawat) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|