
MS010619.1 (mRNA) Bitter gourd (TR) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATAATGTTTTTTTTTTTTTGGTTGCAGAGGGTGGAGATAAAAGTGAAGATGGACTGCGAAGGGTGCGAGAGGAAGGTGAAGAAGTCGGTGGAGGGGATGAAGGGGGTGACGGAGGTGGAGGTGGAGCCGAAGCGGAGCAAGCTTACGGTGGTCGGTTACGTGGACCCCGACAAGGTCCTCCGCCGCGTCCGCCACCGGACCGGGAAGACGGCGGACCTCTGGCCCTACGTGCCC ATAATGTTTTTTTTTTTTTGGTTGCAGAGGGTGGAGATAAAAGTGAAGATGGACTGCGAAGGGTGCGAGAGGAAGGTGAAGAAGTCGGTGGAGGGGATGAAGGGGGTGACGGAGGTGGAGGTGGAGCCGAAGCGGAGCAAGCTTACGGTGGTCGGTTACGTGGACCCCGACAAGGTCCTCCGCCGCGTCCGCCACCGGACCGGGAAGACGGCGGACCTCTGGCCCTACGTGCCC ATAATGTTTTTTTTTTTTTGGTTGCAGAGGGTGGAGATAAAAGTGAAGATGGACTGCGAAGGGTGCGAGAGGAAGGTGAAGAAGTCGGTGGAGGGGATGAAGGGGGTGACGGAGGTGGAGGTGGAGCCGAAGCGGAGCAAGCTTACGGTGGTCGGTTACGTGGACCCCGACAAGGTCCTCCGCCGCGTCCGCCACCGGACCGGGAAGACGGCGGACCTCTGGCCCTACGTGCCC IMFFFFWLQRVEIKVKMDCEGCERKVKKSVEGMKGVTEVEVEPKRSKLTVVGYVDPDKVLRRVRHRTGKTADLWPYVP Homology
BLAST of MS010619.1 vs. NCBI nr
Match: XP_022133091.1 (heavy metal-associated isoprenylated plant protein 27 [Momordica charantia]) HSP 1 Score: 147.1 bits (370), Expect = 6.2e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of MS010619.1 vs. NCBI nr
Match: XP_023518572.1 (heavy metal-associated isoprenylated plant protein 27-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 141.7 bits (356), Expect = 2.6e-30 Identity = 68/71 (95.77%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MS010619.1 vs. NCBI nr
Match: XP_022926427.1 (heavy metal-associated isoprenylated plant protein 27-like [Cucurbita moschata] >XP_023003938.1 heavy metal-associated isoprenylated plant protein 27 [Cucurbita maxima] >KAG6594761.1 Heavy metal-associated isoprenylated plant protein 27, partial [Cucurbita argyrosperma subsp. sororia] >KAG7026727.1 Heavy metal-associated isoprenylated plant protein 27, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 141.4 bits (355), Expect = 3.4e-30 Identity = 68/71 (95.77%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MS010619.1 vs. NCBI nr
Match: XP_038883487.1 (heavy metal-associated isoprenylated plant protein 27 [Benincasa hispida]) HSP 1 Score: 139.4 bits (350), Expect = 1.3e-29 Identity = 66/71 (92.96%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of MS010619.1 vs. NCBI nr
Match: XP_008440850.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 27 [Cucumis melo]) HSP 1 Score: 134.4 bits (337), Expect = 4.2e-28 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy Swiss-Prot
Match: Q67ZW1 (Heavy metal-associated isoprenylated plant protein 27 OS=Arabidopsis thaliana OX=3702 GN=HIPP27 PE=1 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 1.5e-25 Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy Swiss-Prot
Match: Q9SZN7 (Heavy metal-associated isoprenylated plant protein 26 OS=Arabidopsis thaliana OX=3702 GN=HIPP26 PE=1 SV=1) HSP 1 Score: 115.9 bits (289), Expect = 2.0e-25 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy Swiss-Prot
Match: O49613 (Heavy metal-associated isoprenylated plant protein 25 OS=Arabidopsis thaliana OX=3702 GN=HIPP25 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 1.9e-20 Identity = 41/71 (57.75%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy Swiss-Prot
Match: Q9C9A3 (Heavy metal-associated isoprenylated plant protein 20 OS=Arabidopsis thaliana OX=3702 GN=HIPP20 PE=1 SV=1) HSP 1 Score: 94.4 bits (233), Expect = 6.3e-19 Identity = 45/71 (63.38%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy Swiss-Prot
Match: Q9LF57 (Heavy metal-associated isoprenylated plant protein 21 OS=Arabidopsis thaliana OX=3702 GN=HIPP21 PE=1 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 1.4e-18 Identity = 44/71 (61.97%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy TrEMBL
Match: A0A6J1BU19 (heavy metal-associated isoprenylated plant protein 27 OS=Momordica charantia OX=3673 GN=LOC111005771 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 3.0e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy TrEMBL
Match: A0A6J1KY22 (heavy metal-associated isoprenylated plant protein 27 OS=Cucurbita maxima OX=3661 GN=LOC111497381 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.6e-30 Identity = 68/71 (95.77%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy TrEMBL
Match: A0A6J1EEF9 (heavy metal-associated isoprenylated plant protein 27-like OS=Cucurbita moschata OX=3662 GN=LOC111433584 PE=4 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.6e-30 Identity = 68/71 (95.77%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy TrEMBL
Match: A0A5D3CQC7 (Heavy metal-associated isoprenylated plant protein 27 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G001100 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.0e-28 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of MS010619.1 vs. ExPASy TrEMBL
Match: A0A7J6FVX2 (HMA domain-containing protein OS=Cannabis sativa OX=3483 GN=F8388_007745 PE=4 SV=1) HSP 1 Score: 134.4 bits (337), Expect = 2.0e-28 Identity = 62/71 (87.32%), Postives = 69/71 (97.18%), Query Frame = 0
BLAST of MS010619.1 vs. TAIR 10
Match: AT5G66110.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 116.3 bits (290), Expect = 1.1e-26 Identity = 53/70 (75.71%), Postives = 63/70 (90.00%), Query Frame = 0
BLAST of MS010619.1 vs. TAIR 10
Match: AT4G38580.1 (farnesylated protein 6 ) HSP 1 Score: 115.9 bits (289), Expect = 1.4e-26 Identity = 53/71 (74.65%), Postives = 62/71 (87.32%), Query Frame = 0
BLAST of MS010619.1 vs. TAIR 10
Match: AT4G35060.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 99.4 bits (246), Expect = 1.4e-21 Identity = 41/71 (57.75%), Postives = 61/71 (85.92%), Query Frame = 0
BLAST of MS010619.1 vs. TAIR 10
Match: AT1G71050.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 94.4 bits (233), Expect = 4.4e-20 Identity = 45/71 (63.38%), Postives = 55/71 (77.46%), Query Frame = 0
BLAST of MS010619.1 vs. TAIR 10
Match: AT5G17450.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 93.2 bits (230), Expect = 9.9e-20 Identity = 44/71 (61.97%), Postives = 57/71 (80.28%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (TR) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|