MC10g0355.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAGCAAGAAGATTGTTGTTGTGGTGGCGCTGGTGGCGATGATGCTGGTCGCAACATCGGCCGCCTTCGACGAGGGCGACACGAGACCCACGAGACCTCTCGTCTCCGACGATGGAGCTGTAGTTGGTCAAGGCATGAATGATTATCCAAGAAAAATGTTTGTGAAAGTTGTGTATTACGAGAATCAAAGAGGGTGTCCGAGAATCTTGAAGCAATGCAAACAGGACTCGGATTGCCCCGGTGAGTGTATTTGCATGGCGCATGGGTTCTGCGGT ATGGAGAGCAAGAAGATTGTTGTTGTGGTGGCGCTGGTGGCGATGATGCTGGTCGCAACATCGGCCGCCTTCGACGAGGGCGACACGAGACCCACGAGACCTCTCGTCTCCGACGATGGAGCTGTAGTTGGTCAAGGCATGAATGATTATCCAAGAAAAATGTTTGTGAAAGTTGTGTATTACGAGAATCAAAGAGGGTGTCCGAGAATCTTGAAGCAATGCAAACAGGACTCGGATTGCCCCGGTGAGTGTATTTGCATGGCGCATGGGTTCTGCGGT ATGGAGAGCAAGAAGATTGTTGTTGTGGTGGCGCTGGTGGCGATGATGCTGGTCGCAACATCGGCCGCCTTCGACGAGGGCGACACGAGACCCACGAGACCTCTCGTCTCCGACGATGGAGCTGTAGTTGGTCAAGGCATGAATGATTATCCAAGAAAAATGTTTGTGAAAGTTGTGTATTACGAGAATCAAAGAGGGTGTCCGAGAATCTTGAAGCAATGCAAACAGGACTCGGATTGCCCCGGTGAGTGTATTTGCATGGCGCATGGGTTCTGCGGT MESKKIVVVVALVAMMLVATSAAFDEGDTRPTRPLVSDDGAVVGQGMNDYPRKMFVKVVYYENQRGCPRILKQCKQDSDCPGECICMAHGFCG Homology
BLAST of MC10g0355.1 vs. ExPASy Swiss-Prot
Match: Q9S747 (Trypsin inhibitor 3 OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 1.0e-12 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy Swiss-Prot
Match: P10294 (Trypsin inhibitor 1 OS=Momordica charantia OX=3673 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.6e-11 Identity = 27/30 (90.00%), Postives = 29/30 (96.67%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy Swiss-Prot
Match: P82410 (Trypsin inhibitor 3 OS=Momordica cochinchinensis OX=3674 PE=1 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.2e-08 Identity = 22/30 (73.33%), Postives = 27/30 (90.00%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy Swiss-Prot
Match: P07853 (Trypsin inhibitor 4 OS=Cucurbita maxima OX=3661 PE=1 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 8.6e-07 Identity = 19/30 (63.33%), Postives = 25/30 (83.33%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy Swiss-Prot
Match: P01074 (Trypsin inhibitor 1 OS=Cucurbita maxima OX=3661 PE=1 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 19/29 (65.52%), Postives = 24/29 (82.76%), Query Frame = 0
BLAST of MC10g0355.1 vs. NCBI nr
Match: AIZ03437.1 (TIPRE1 precursor, partial [Momordica anigosantha]) HSP 1 Score: 82.0 bits (201), Expect = 7.14e-18 Identity = 44/83 (53.01%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of MC10g0355.1 vs. NCBI nr
Match: AIZ03439.1 (TIPRE3 precursor, partial [Momordica anigosantha]) HSP 1 Score: 84.3 bits (207), Expect = 1.40e-17 Identity = 44/82 (53.66%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MC10g0355.1 vs. NCBI nr
Match: AIZ03438.1 (TIPRE2 precursor, partial [Momordica anigosantha]) HSP 1 Score: 82.0 bits (201), Expect = 3.17e-17 Identity = 44/83 (53.01%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of MC10g0355.1 vs. NCBI nr
Match: AIZ03440.1 (TIPRE4 precursor, partial [Momordica anigosantha]) HSP 1 Score: 84.3 bits (207), Expect = 3.67e-17 Identity = 44/82 (53.66%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MC10g0355.1 vs. NCBI nr
Match: AIZ03441.1 (TIPRE5 precursor, partial [Momordica friesiorum]) HSP 1 Score: 79.0 bits (193), Expect = 1.17e-16 Identity = 43/83 (51.81%), Postives = 54/83 (65.06%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy TrEMBL
Match: A0A0A7HG47 (TIPRE1 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE1 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 3.45e-18 Identity = 44/83 (53.01%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy TrEMBL
Match: A0A0A7HF94 (TIPRE3 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE3 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 6.78e-18 Identity = 44/82 (53.66%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy TrEMBL
Match: A0A0A7HF33 (TIPRE2 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE2 PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 1.53e-17 Identity = 44/83 (53.01%), Postives = 55/83 (66.27%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy TrEMBL
Match: A0A0A7HIT2 (TIPRE4 (Fragment) OS=Momordica anigosantha OX=703354 GN=TIPRE4 PE=3 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 1.78e-17 Identity = 44/82 (53.66%), Postives = 55/82 (67.07%), Query Frame = 0
BLAST of MC10g0355.1 vs. ExPASy TrEMBL
Match: A0A0A7HIA9 (TIPRE5 (Fragment) OS=Momordica friesiorum OX=703365 GN=TIPRE5 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 5.64e-17 Identity = 43/83 (51.81%), Postives = 54/83 (65.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|