MC09g0355.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACAGGTTTCCCAGCATTTTTCTCAAAATTTCAGGACAGAGTACAGATTTTCTTTGCTGTGTTATTCTGGATGTCCCTCTTCTTCTGGACTTCAGTATTGGATGGAAAAAATAGACCCAATAAGGGCTCTCGATTTAGACGA ACAGGTTTCCCAGCATTTTTCTCAAAATTTCAGGACAGAGTACAGATTTTCTTTGCTGTGTTATTCTGGATGTCCCTCTTCTTCTGGACTTCAGTATTGGATGGAAAAAATAGACCCAATAAGGGCTCTCGATTTAGACGA ACAGGTTTCCCAGCATTTTTCTCAAAATTTCAGGACAGAGTACAGATTTTCTTTGCTGTGTTATTCTGGATGTCCCTCTTCTTCTGGACTTCAGTATTGGATGGAAAAAATAGACCCAATAAGGGCTCTCGATTTAGACGA TGFPAFFSKFQDRVQIFFAVLFWMSLFFWTSVLDGKNRPNKGSRFRR Homology
BLAST of MC09g0355.1 vs. NCBI nr
Match: XP_022145821.1 (uncharacterized protein LOC111015178 [Momordica charantia]) HSP 1 Score: 98.6 bits (244), Expect = 5.38e-25 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC09g0355.1 vs. NCBI nr
Match: KAG6593392.1 (hypothetical protein SDJN03_12868, partial [Cucurbita argyrosperma subsp. sororia] >KAG7025739.1 hypothetical protein SDJN02_12237, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 92.0 bits (227), Expect = 2.56e-22 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC09g0355.1 vs. NCBI nr
Match: XP_022959617.1 (uncharacterized protein LOC111460643 isoform X1 [Cucurbita moschata]) HSP 1 Score: 92.0 bits (227), Expect = 2.56e-22 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC09g0355.1 vs. NCBI nr
Match: XP_023004358.1 (uncharacterized protein LOC111497700 isoform X1 [Cucurbita maxima]) HSP 1 Score: 92.0 bits (227), Expect = 2.56e-22 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC09g0355.1 vs. NCBI nr
Match: XP_008461116.1 (PREDICTED: uncharacterized protein LOC103499798 [Cucumis melo]) HSP 1 Score: 90.9 bits (224), Expect = 6.23e-22 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MC09g0355.1 vs. ExPASy TrEMBL
Match: A0A6J1CXJ1 (uncharacterized protein LOC111015178 OS=Momordica charantia OX=3673 GN=LOC111015178 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 2.61e-25 Identity = 46/46 (100.00%), Postives = 46/46 (100.00%), Query Frame = 0
BLAST of MC09g0355.1 vs. ExPASy TrEMBL
Match: A0A6J1KZ93 (uncharacterized protein LOC111497700 isoform X1 OS=Cucurbita maxima OX=3661 GN=LOC111497700 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 1.24e-22 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC09g0355.1 vs. ExPASy TrEMBL
Match: A0A6J1H516 (uncharacterized protein LOC111460643 isoform X1 OS=Cucurbita moschata OX=3662 GN=LOC111460643 PE=4 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 1.24e-22 Identity = 43/46 (93.48%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of MC09g0355.1 vs. ExPASy TrEMBL
Match: A0A1S3CE06 (uncharacterized protein LOC103499798 OS=Cucumis melo OX=3656 GN=LOC103499798 PE=4 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 3.01e-22 Identity = 42/47 (89.36%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MC09g0355.1 vs. ExPASy TrEMBL
Match: A0A0A0K8T0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_7G432560 PE=4 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 9.08e-22 Identity = 41/47 (87.23%), Postives = 43/47 (91.49%), Query Frame = 0
BLAST of MC09g0355.1 vs. TAIR 10
Match: AT3G15780.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G52550.1); Has 20 Blast hits to 20 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 20; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 52.0 bits (123), Expect = 1.5e-07 Identity = 25/47 (53.19%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of MC09g0355.1 vs. TAIR 10
Match: AT1G52550.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G15780.1); Has 53 Blast hits to 51 proteins in 18 species: Archae - 0; Bacteria - 8; Metazoa - 4; Fungi - 0; Plants - 23; Viruses - 8; Other Eukaryotes - 10 (source: NCBI BLink). ) HSP 1 Score: 48.5 bits (114), Expect = 1.7e-06 Identity = 23/44 (52.27%), Postives = 29/44 (65.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|