![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
MC08g0716.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CGGCTTGATGACTTTACATTTACATTTACTTTGTACTGCAAGAATGGTAAAGTTGATGGGGCACGGAAGATTTTTTATGAGATGCCAGTTAAAGATATCGTTACTTGGAATGCAATCTTATCAGGGTATGTGAATGCAAGGCGTATGGACGAGCCAAAATCTTTCTTCGCAGAAATGCCAGGGAAAACCCTTCTTACTTGGACTGTGATGATTTCAGGATTAGCAAAAAATGGATTTGGGGAAGATGGTTTGAAGCTGTTTAACCAAATGAGGTTAGACGATTATTAACCCTGTGATTATGCACTTGCAGGAGCCATTACAGCTTGTTCTGTGCTTGGAGCATTGGAGAATGTCGCCAGCTCCATGCTCAGCTTGTTCATCTTGGCCACAGTTCAACACTCTCAGATGGCAATGCAATGATCTCA CGGCTTGATGACTTTACATTTACATTTACTTTGTACTGCAAGAATGGTAAAGTTGATGGGGCACGGAAGATTTTTTATGAGATGCCAGTTAAAGATATCGTTACTTGGAATGCAATCTTATCAGGGTATGTGAATGCAAGGCGTATGGACGAGCCAAAATCTTTCTTCGCAGAAATGCCAGGGAAAACCCTTCTTACTTGGACTGTGATGATTTCAGGATTAGCAAAAAATGGATTTGGGGAAGATGGTTTGAAGCTGTTTAACCAAATGAGGTTAGACGATTATTAACCCTGTGATTATGCACTTGCAGGAGCCATTACAGCTTGTTCTGTGCTTGGAGCATTGGAGAATCGCCAGCTCCATGCTCAGCTTGTTCATCTTGGCCACAGTTCAACACTCTCAGATGGCAATGCAATGATCTCA CGGCTTGATGACTTTACATTTACATTTACTTTGTACTGCAAGAATGGTAAAGTTGATGGGGCACGGAAGATTTTTTATGAGATGCCAGTTAAAGATATCGTTACTTGGAATGCAATCTTATCAGGGTATGTGAATGCAAGGCGTATGGACGAGCCAAAATCTTTCTTCGCAGAAATGCCAGGGAAAACCCTTCTTACTTGGACTGTGATGATTTCAGGATTAGCAAAAAATGGATTTGGGGAAGATGGTTTGAAGCTGTTTAACCAAATGAGGTTAGACGATTATTAACCCTGTGATTATGCACTTGCAGGAGCCATTACAGCTTGTTCTGTGCTTGGAGCATTGGAGAATCGCCAGCTCCATGCTCAGCTTGTTCATCTTGGCCACAGTTCAACACTCTCAGATGGCAATGCAATGATCTCA RLDDFTFTFTLYCKNGKVDGARKIFYEMPVKDIVTWNAILSGYVNARRMDEPKSFFAEMPGKTLLTWTVMISGLAKNGFGEDGLKLFNQMRLDDYUPCDYALAGAITACSVLGALENRQLHAQLVHLGHSSTLSDGNAMIS Homology
BLAST of MC08g0716.1 vs. ExPASy Swiss-Prot
Match: Q9FRI5 (Pentatricopeptide repeat-containing protein At1g25360 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H74 PE=2 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 8.9e-40 Identity = 80/147 (54.42%), Postives = 108/147 (73.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy Swiss-Prot
Match: Q9LXF2 (Pentatricopeptide repeat-containing protein At5g15300 OS=Arabidopsis thaliana OX=3702 GN=PCMP-E40 PE=2 SV=2) HSP 1 Score: 92.0 bits (227), Expect = 5.6e-18 Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy Swiss-Prot
Match: Q9LN01 (Pentatricopeptide repeat-containing protein At1g08070, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PCMP-H12 PE=2 SV=1) HSP 1 Score: 92.0 bits (227), Expect = 5.6e-18 Identity = 42/136 (30.88%), Postives = 79/136 (58.09%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy Swiss-Prot
Match: Q9FJY7 (Pentatricopeptide repeat-containing protein At5g66520 OS=Arabidopsis thaliana OX=3702 GN=PCMP-H61 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.3e-17 Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy Swiss-Prot
Match: Q9MA50 (Pentatricopeptide repeat-containing protein At1g05750, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PDE247 PE=2 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.3e-17 Identity = 39/105 (37.14%), Postives = 62/105 (59.05%), Query Frame = 0
BLAST of MC08g0716.1 vs. NCBI nr
Match: XP_022144208.1 (pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144209.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144210.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144211.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144212.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144213.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144365.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144367.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144368.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144369.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144370.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144371.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144372.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia] >XP_022144373.1 pentatricopeptide repeat-containing protein At1g25360-like [Momordica charantia]) HSP 1 Score: 231 bits (590), Expect = 1.03e-68 Identity = 113/133 (84.96%), Postives = 120/133 (90.23%), Query Frame = 0
BLAST of MC08g0716.1 vs. NCBI nr
Match: XP_038886633.1 (pentatricopeptide repeat-containing protein At1g25360-like [Benincasa hispida]) HSP 1 Score: 227 bits (578), Expect = 5.55e-67 Identity = 111/133 (83.46%), Postives = 121/133 (90.98%), Query Frame = 0
BLAST of MC08g0716.1 vs. NCBI nr
Match: XP_023002238.1 (pentatricopeptide repeat-containing protein At1g25360-like [Cucurbita maxima]) HSP 1 Score: 226 bits (576), Expect = 1.08e-66 Identity = 111/133 (83.46%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. NCBI nr
Match: KAG7020472.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 225 bits (574), Expect = 2.09e-66 Identity = 110/133 (82.71%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. NCBI nr
Match: KAG6585558.1 (Pentatricopeptide repeat-containing protein, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 225 bits (574), Expect = 2.09e-66 Identity = 110/133 (82.71%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy TrEMBL
Match: A0A6J1CRF6 (pentatricopeptide repeat-containing protein At1g25360-like OS=Momordica charantia OX=3673 GN=LOC111014069 PE=3 SV=1) HSP 1 Score: 231 bits (590), Expect = 4.99e-69 Identity = 113/133 (84.96%), Postives = 120/133 (90.23%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy TrEMBL
Match: A0A6J1KSZ4 (pentatricopeptide repeat-containing protein At1g25360-like OS=Cucurbita maxima OX=3661 GN=LOC111496149 PE=3 SV=1) HSP 1 Score: 226 bits (576), Expect = 5.21e-67 Identity = 111/133 (83.46%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy TrEMBL
Match: A0A6J1GGL5 (pentatricopeptide repeat-containing protein At1g25360-like OS=Cucurbita moschata OX=3662 GN=LOC111454019 PE=3 SV=1) HSP 1 Score: 225 bits (574), Expect = 1.01e-66 Identity = 110/133 (82.71%), Postives = 119/133 (89.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy TrEMBL
Match: A0A1S4DVG9 (pentatricopeptide repeat-containing protein At1g25360-like OS=Cucumis melo OX=3656 GN=LOC103488043 PE=3 SV=1) HSP 1 Score: 221 bits (564), Expect = 1.33e-65 Identity = 108/133 (81.20%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of MC08g0716.1 vs. ExPASy TrEMBL
Match: A0A0A0LL72 (DYW_deaminase domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G368270 PE=3 SV=1) HSP 1 Score: 222 bits (566), Expect = 1.43e-65 Identity = 109/133 (81.95%), Postives = 117/133 (87.97%), Query Frame = 0
BLAST of MC08g0716.1 vs. TAIR 10
Match: AT1G25360.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 164.5 bits (415), Expect = 6.3e-41 Identity = 80/147 (54.42%), Postives = 108/147 (73.47%), Query Frame = 0
BLAST of MC08g0716.1 vs. TAIR 10
Match: AT1G08070.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 92.0 bits (227), Expect = 4.0e-19 Identity = 42/136 (30.88%), Postives = 79/136 (58.09%), Query Frame = 0
BLAST of MC08g0716.1 vs. TAIR 10
Match: AT5G15300.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 92.0 bits (227), Expect = 4.0e-19 Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 0
BLAST of MC08g0716.1 vs. TAIR 10
Match: AT1G05750.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 90.9 bits (224), Expect = 8.9e-19 Identity = 39/105 (37.14%), Postives = 62/105 (59.05%), Query Frame = 0
BLAST of MC08g0716.1 vs. TAIR 10
Match: AT5G66520.1 (Tetratricopeptide repeat (TPR)-like superfamily protein ) HSP 1 Score: 90.9 bits (224), Expect = 8.9e-19 Identity = 42/114 (36.84%), Postives = 68/114 (59.65%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|