MC05g0795.1 (mRNA) Bitter gourd (Dali-11) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.TTGTTACACACAACACCCCTTAGAGGAAGGGTCAAGCAAGGTGGACAACGGGTGAGAGAAATAGAGGTTTGGGCTCTAGAAGAATTTGATGTTGCTCATATTTTGCCTTACTTTATAAATCTGATCATATTAAAGCTCGACAAAAAATACTTGATACTACGATCATT TTGTTACACACAACACCCCTTAGAGGAAGGGTCAAGCAAGGTGGACAACGGGTGAGAGAAATAGAGGTTTGGGCTCTAGAAGAATTTGATGTTGCTCATATTTTGTTACTTTATAAATCTGATCATATTAAAGCTCGACAAAAAATACTTGATACTACGATCATT TTGTTACACACAACACCCCTTAGAGGAAGGGTCAAGCAAGGTGGACAACGGGTGAGAGAAATAGAGGTTTGGGCTCTAGAAGAATTTGATGTTGCTCATATTTTGTTACTTTATAAATCTGATCATATTAAAGCTCGACAAAAAATACTTGATACTACGATCATT LLHTTPLRGRVKQGGQRVREIEVWALEEFDVAHILLLYKSDHIKARQKILDTTII Homology
BLAST of MC05g0795.1 vs. ExPASy Swiss-Prot
Match: P11703 (DNA-directed RNA polymerase subunit beta OS=Spinacia oleracea OX=3562 GN=rpoB PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 8.6e-15 Identity = 42/58 (72.41%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy Swiss-Prot
Match: Q589C0 (DNA-directed RNA polymerase subunit beta OS=Silene latifolia OX=37657 GN=rpoB PE=3 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 1.5e-14 Identity = 42/58 (72.41%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy Swiss-Prot
Match: A9LYH7 (DNA-directed RNA polymerase subunit beta OS=Acorus americanus OX=263995 GN=rpoB PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.9e-14 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy Swiss-Prot
Match: Q3V542 (DNA-directed RNA polymerase subunit beta OS=Acorus calamus OX=4465 GN=rpoB PE=3 SV=2) HSP 1 Score: 79.0 bits (193), Expect = 1.9e-14 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy Swiss-Prot
Match: Q5QA72 (DNA-directed RNA polymerase subunit beta OS=Acorus gramineus OX=55184 GN=rpoB PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 1.9e-14 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. NCBI nr
Match: BBN70082.1 (hypothetical protein Prudu_1405S000400 [Prunus dulcis]) HSP 1 Score: 77.8 bits (190), Expect = 1.06e-16 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. NCBI nr
Match: NLZ73073.1 (DNA-directed RNA polymerase subunit beta [Bacteroidales bacterium]) HSP 1 Score: 77.4 bits (189), Expect = 1.98e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. NCBI nr
Match: PHT86502.1 (hypothetical protein T459_08608 [Capsicum annuum]) HSP 1 Score: 76.3 bits (186), Expect = 5.09e-16 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. NCBI nr
Match: WP_199287517.1 (hypothetical protein, partial [Photobacterium chitinilyticum] >RWX52626.1 DNA-directed RNA polymerase subunit beta, partial [Photobacterium chitinilyticum]) HSP 1 Score: 77.0 bits (188), Expect = 5.21e-16 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. NCBI nr
Match: VVW90808.1 (unnamed protein product, partial [Nymphaea colorata]) HSP 1 Score: 77.4 bits (189), Expect = 5.38e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy TrEMBL
Match: A0A5H2XTM0 (DNA-directed RNA polymerase OS=Prunus dulcis OX=3755 GN=Prudu_1405S000400 PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 5.11e-17 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy TrEMBL
Match: A0A7X8ZSZ9 (DNA-directed RNA polymerase subunit beta OS=Bacteroidales bacterium OX=2030927 GN=GX905_04560 PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 9.56e-17 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy TrEMBL
Match: A0A2G2ZWY2 (DNA-directed RNA polymerase OS=Capsicum annuum OX=4072 GN=T459_08608 PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.46e-16 Identity = 39/58 (67.24%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy TrEMBL
Match: A0A444JHR1 (DNA-directed RNA polymerase (Fragment) OS=Photobacterium chitinilyticum OX=2485123 GN=EDI28_26660 PE=4 SV=1) HSP 1 Score: 77.0 bits (188), Expect = 2.52e-16 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. ExPASy TrEMBL
Match: A0A5K1HTK9 (DNA-directed RNA polymerase (Fragment) OS=Nymphaea colorata OX=210225 GN=NYM_LOCUS30763 PE=3 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 2.60e-16 Identity = 40/58 (68.97%), Postives = 46/58 (79.31%), Query Frame = 0
BLAST of MC05g0795.1 vs. TAIR 10
Match: ATCG00190.1 (RNA polymerase subunit beta ) HSP 1 Score: 78.2 bits (191), Expect = 2.3e-15 Identity = 41/58 (70.69%), Postives = 46/58 (79.31%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bitter gourd (Dali-11) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|