![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Lsi01G019770.1 (mRNA) Bottle gourd (USVL1VR-Ls) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCTTAAGATACAAAGAGAAGCTCTCAGTAATTAGAAAAAGACATGGCTGATATTCCTTTCCCTATTCCTGGTAAGCCTAATTCAAAACCTTTACATCACTTCTCTAAACTAACAACATTTGAAAATTTTGAATCTCATTTTTAAATATATTTATAAATTGAATTGTTTTTTTATAGAAGTTATTACGTTAAAGATCAATATTTGGAGATGAATTGTAGAACTTGTTATAGTGTTAATGGTTGATTGAACATAAAAGATCATACTATTTATTCACTTTTGTCAAACAAATGGCAAATGATGTTTTCGTTTTTAGAAGTGTTTTCATTTAGTTTAATATTTGGAGATGAATCGTAGAACTTGTTATTTATATACTACTAATTTGTTGTAAAGACTTGTTTGGTAGCCAATCTAAAAATATAAATTCAGATTGATTATCAAACACATATTTGTTAAACTAAGTGAATCTGAAAACACGAAACAATATTCAAATTGCCAACTAAATAAATCCTAAATTATTTGTACTAATTAATGAAATATTATTTTGATCCATTAGGAAAATCATCATGGCCAGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA CCTTAAGATACAAAGAGAAGCTCTCAGTAATTAGAAAAAGACATGGCTGATATTCCTTTCCCTATTCCTGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA ATGGCTGATATTCCTTTCCCTATTCCTGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA MADIPFPIPELVGIEAEIAKLVIQKDNPRVEIIDIILAGSPVPRDFRQDRVRIFVNIRNVAVEIPIIG Homology
BLAST of Lsi01G019770.1 vs. ExPASy Swiss-Prot
Match: P16231 (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy Swiss-Prot
Match: Q02214 (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.5e-10 Identity = 28/60 (46.67%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy Swiss-Prot
Match: Q00783 (Proteinase inhibitor 1 OS=Solanum tuberosum OX=4113 PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.8e-09 Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy Swiss-Prot
Match: P05118 (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 GN=PIIF PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.0e-09 Identity = 26/59 (44.07%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy Swiss-Prot
Match: P20076 (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 26/60 (43.33%), Postives = 42/60 (70.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy TrEMBL
Match: A0A6N2B0Y4 (Uncharacterized protein OS=Solanum chilense OX=4083 GN=EJD97_018437 PE=3 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 2.4e-09 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy TrEMBL
Match: Q40444 (Tumor-related protein (Fragment) OS=Nicotiana glauca x Nicotiana langsdorffii OX=79230 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 5.3e-09 Identity = 30/60 (50.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy TrEMBL
Match: A0A0A0KME7 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 6.9e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy TrEMBL
Match: A0A0A0KMM0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G285030 PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 9.1e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. ExPASy TrEMBL
Match: A0A2G2VTY8 (Ethylene-responsive proteinase inhibitor 1 OS=Capsicum baccatum OX=33114 GN=CQW23_24145 PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 9.1e-09 Identity = 31/60 (51.67%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. NCBI nr
Match: KAG6571499.1 (Proteinase inhibitor I-B, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 74.7 bits (182), Expect = 3.4e-10 Identity = 37/60 (61.67%), Postives = 44/60 (73.33%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. NCBI nr
Match: XP_004247658.1 (wound-induced proteinase inhibitor 1 [Solanum lycopersicum]) HSP 1 Score: 73.2 bits (178), Expect = 9.9e-10 Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. NCBI nr
Match: KAG6571494.1 (hypothetical protein SDJN03_28222, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 72.8 bits (177), Expect = 1.3e-09 Identity = 36/60 (60.00%), Postives = 46/60 (76.67%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. NCBI nr
Match: TMW88525.1 (hypothetical protein EJD97_018437 [Solanum chilense]) HSP 1 Score: 70.9 bits (172), Expect = 4.9e-09 Identity = 34/60 (56.67%), Postives = 45/60 (75.00%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. NCBI nr
Match: BAA05472.1 (tumor-related protein, partial [Nicotiana glauca x Nicotiana langsdorffii]) HSP 1 Score: 69.7 bits (169), Expect = 1.1e-08 Identity = 30/60 (50.00%), Postives = 47/60 (78.33%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. TAIR 10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 54.3 bits (129), Expect = 4.4e-08 Identity = 28/60 (46.67%), Postives = 38/60 (63.33%), Query Frame = 0
BLAST of Lsi01G019770.1 vs. TAIR 10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein ) HSP 1 Score: 52.4 bits (124), Expect = 1.7e-07 Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (USVL1VR-Ls) v1
Date Performed: 2021-10-18 Position : 0 Zoom : x 1
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|