IVF0022288.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTAAAGAAGGAATTGTGCTTGGGAACAAGATCTCCCATGTGGGATTAGAAGTAGACCCCGCAAAGATTAATATGGTAAGTAAATTGCCACCACCTTCAAATGTCAAGCCTTTGAGAAGCTTTTTGGGTTAAGTAGGATTTTACAGAAGATTCATTGGAGGATTTTCCCAGATCACCAAACCTCTCAATAACCTGCTATGCATCAATCAACCCTTTGACTTTGATGAGGAATGCAATTAAGCGTTTCAAACTATAAAAGACGCGTTGACCTCAACATCTATCCTTATCACGCCAAATTGGTCACAACCATTTGAACTTATGTGTGACACGAGTCATGTGGCAGTAAGGGCTATGCTGGGTCAAAAGAAGGATAAAATGATCCACCCTATCTACTATGCGAGCAAAACCCTTAACGAAGCTCAAGAGAATTATACTACCACTAAGAAGGAGCTGCTCGCAGTAGTATTTGCGATAGAAAAGTTTAGGAGCTACATTGTAGGCTCCAAAGTTAGAGCATTCTGA ATGGTTAAAGAAGGAATTGTGCTTGGGAACAAGATCTCCCATGTGGGATTAGAAGTAGACCCCGCAAAGATTAATATGGTAAGTAAATTGCCACCACCTTCAAATGTCAAGCCTTTGAGAAGCTTTTTGGCGTTTCAAACTATAAAAGACGCGTTGACCTCAACATCTATCCTTATCACGCCAAATTGGTCACAACCATTTGAACTTATGTGTGACACGAGTCATGTGGCAGTAAGGGCTATGCTGGGTCAAAAGAAGGATAAAATGATCCACCCTATCTACTATGCGAGCAAAACCCTTAACGAAGCTCAAGAGAATTATACTACCACTAAGAAGGAGCTGCTCGCAGTAGTATTTGCGATAGAAAAGTTTAGGAGCTACATTGTAGGCTCCAAAGTTAGAGCATTCTGA ATGGTTAAAGAAGGAATTGTGCTTGGGAACAAGATCTCCCATGTGGGATTAGAAGTAGACCCCGCAAAGATTAATATGGTAAGTAAATTGCCACCACCTTCAAATGTCAAGCCTTTGAGAAGCTTTTTGGCGTTTCAAACTATAAAAGACGCGTTGACCTCAACATCTATCCTTATCACGCCAAATTGGTCACAACCATTTGAACTTATGTGTGACACGAGTCATGTGGCAGTAAGGGCTATGCTGGGTCAAAAGAAGGATAAAATGATCCACCCTATCTACTATGCGAGCAAAACCCTTAACGAAGCTCAAGAGAATTATACTACCACTAAGAAGGAGCTGCTCGCAGTAGTATTTGCGATAGAAAAGTTTAGGAGCTACATTGTAGGCTCCAAAGTTAGAGCATTCTGA MVKEGIVLGNKISHVGLEVDPAKINMVSKLPPPSNVKPLRSFLAFQTIKDALTSTSILITPNWSQPFELMCDTSHVAVRAMLGQKKDKMIHPIYYASKTLNEAQENYTTTKKELLAVVFAIEKFRSYIVGSKVRAF Homology
BLAST of IVF0022288.1 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 4.3e-15 Identity = 48/173 (27.75%), Postives = 83/173 (47.98%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 6.8e-13 Identity = 50/167 (29.94%), Postives = 82/167 (49.10%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 4.9e-11 Identity = 47/167 (28.14%), Postives = 79/167 (47.31%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy Swiss-Prot
Match: P10401 (Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.7e-09 Identity = 45/175 (25.71%), Postives = 78/175 (44.57%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy Swiss-Prot
Match: Q9UR07 (Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-11 PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 1.3e-06 Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy TrEMBL
Match: A0A5D3DS34 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold313G001700 PE=4 SV=1) HSP 1 Score: 184.1 bits (466), Expect = 3.9e-43 Identity = 98/139 (70.50%), Postives = 113/139 (81.29%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy TrEMBL
Match: A0A5N6PFF2 (Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_11117 PE=4 SV=1) HSP 1 Score: 176.0 bits (445), Expect = 1.1e-40 Identity = 91/141 (64.54%), Postives = 111/141 (78.72%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy TrEMBL
Match: A0A5N6NFE7 (Reverse transcriptase OS=Mikania micrantha OX=192012 GN=E3N88_24212 PE=4 SV=1) HSP 1 Score: 172.6 bits (436), Expect = 1.2e-39 Identity = 94/170 (55.29%), Postives = 111/170 (65.29%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy TrEMBL
Match: A0A5N6LN29 (Uncharacterized protein OS=Mikania micrantha OX=192012 GN=E3N88_40523 PE=4 SV=1) HSP 1 Score: 171.4 bits (433), Expect = 2.6e-39 Identity = 92/168 (54.76%), Postives = 112/168 (66.67%), Query Frame = 0
BLAST of IVF0022288.1 vs. ExPASy TrEMBL
Match: A0A5N6NFS2 (Integrase catalytic domain-containing protein OS=Mikania micrantha OX=192012 GN=E3N88_23359 PE=4 SV=1) HSP 1 Score: 171.0 bits (432), Expect = 3.4e-39 Identity = 93/170 (54.71%), Postives = 110/170 (64.71%), Query Frame = 0
BLAST of IVF0022288.1 vs. NCBI nr
Match: TYK26567.1 (Retrovirus-related Pol polyprotein from transposon 17.6 [Cucumis melo var. makuwa]) HSP 1 Score: 186 bits (471), Expect = 2.18e-57 Identity = 98/139 (70.50%), Postives = 113/139 (81.29%), Query Frame = 0
BLAST of IVF0022288.1 vs. NCBI nr
Match: KAD6119846.1 (hypothetical protein E3N88_11117 [Mikania micrantha]) HSP 1 Score: 178 bits (451), Expect = 2.18e-52 Identity = 91/141 (64.54%), Postives = 111/141 (78.72%), Query Frame = 0
BLAST of IVF0022288.1 vs. NCBI nr
Match: KAA0062414.1 (Retrovirus-related Pol polyprotein from transposon 17.6 [Cucumis melo var. makuwa]) HSP 1 Score: 169 bits (428), Expect = 3.32e-51 Identity = 88/130 (67.69%), Postives = 101/130 (77.69%), Query Frame = 0
BLAST of IVF0022288.1 vs. NCBI nr
Match: GFB79506.1 (reverse transcriptase domain-containing protein [Tanacetum cinerariifolium]) HSP 1 Score: 171 bits (432), Expect = 1.12e-49 Identity = 85/134 (63.43%), Postives = 106/134 (79.10%), Query Frame = 0
BLAST of IVF0022288.1 vs. NCBI nr
Match: KAA0060859.1 (Retrovirus-related Pol polyprotein from transposon 17.6 [Cucumis melo var. makuwa]) HSP 1 Score: 167 bits (423), Expect = 3.41e-49 Identity = 89/130 (68.46%), Postives = 104/130 (80.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|