IVF0010604.2 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATCCAATGCGAGGGATCAACTTGAAAGGGATTGTTGAGAAGATGAATGGTGCATCCGATGCTGAAGTTAAGGTCAGTTAGATTTTTACACAAAACATTCCTATTTTTTCTACTTCAGGTGGACAAACTTTAATGTCAATCTTGTTTCATCTTTTCAGGCTGTTTGCACAGAAGTTGGAATGTTTGCTTTAAGAGAAAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATAGCAATTGCAAAGGTTATGAAGAAAGACAAATAA ATGAATCCAATGCGAGGGATCAACTTGAAAGGGATTGTTGAGAAGATGAATGGTGCATCCGATGCTGAAGTTAAGGCTGTTTGCACAGAAGTTGGAATGTTTGCTTTAAGAGAAAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATAGCAATTGCAAAGGTTATGAAGAAAGACAAATAA ATGAATCCAATGCGAGGGATCAACTTGAAAGGGATTGTTGAGAAGATGAATGGTGCATCCGATGCTGAAGTTAAGGCTGTTTGCACAGAAGTTGGAATGTTTGCTTTAAGAGAAAGAAGGGTTCATGTGACACAAGAAGATTTCGAGATAGCAATTGCAAAGGTTATGAAGAAAGACAAATAA MNPMRGINLKGIVEKMNGASDAEVKAVCTEVGMFALRERRVHVTQEDFEIAIAKVMKKDK Homology
BLAST of IVF0010604.2 vs. ExPASy Swiss-Prot
Match: Q9C5U3 (26S proteasome regulatory subunit 8 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT6A PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.7e-21 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy Swiss-Prot
Match: Q94BQ2 (26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1) HSP 1 Score: 100.5 bits (249), Expect = 6.7e-21 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy Swiss-Prot
Match: P34124 (26S proteasome regulatory subunit 8 OS=Dictyostelium discoideum OX=44689 GN=psmC5 PE=1 SV=2) HSP 1 Score: 94.4 bits (233), Expect = 4.8e-19 Identity = 46/59 (77.97%), Postives = 53/59 (89.83%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy Swiss-Prot
Match: P41836 (26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.8e-18 Identity = 45/58 (77.59%), Postives = 50/58 (86.21%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy Swiss-Prot
Match: P62194 (26S proteasome regulatory subunit 8 OS=Bos taurus OX=9913 GN=PSMC5 PE=2 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 9.1e-18 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy TrEMBL
Match: A0A5D3E253 (26S protease regulatory subunit 8-like protein B-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold64G00310 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 3.1e-21 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy TrEMBL
Match: A0A5A7UBM5 (Thioredoxin F-type OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold71G00080 PE=4 SV=1) HSP 1 Score: 102.4 bits (254), Expect = 6.5e-19 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy TrEMBL
Match: A0A5A7TXZ5 (26S protease regulatory subunit 8-like protein B-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold216G00510 PE=4 SV=1) HSP 1 Score: 102.1 bits (253), Expect = 8.5e-19 Identity = 51/55 (92.73%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy TrEMBL
Match: A0A5A7UDC9 (Thioredoxin F-type OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold55G002070 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 1.5e-18 Identity = 50/54 (92.59%), Postives = 52/54 (96.30%), Query Frame = 0
BLAST of IVF0010604.2 vs. ExPASy TrEMBL
Match: A0A2Z7D8Y5 (AAA domain-containing protein OS=Dorcoceras hygrometricum OX=472368 GN=F511_06097 PE=3 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.9e-18 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. NCBI nr
Match: TYK29681.1 (26S protease regulatory subunit 8-like protein B-like [Cucumis melo var. makuwa]) HSP 1 Score: 110 bits (274), Expect = 1.43e-27 Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 0
BLAST of IVF0010604.2 vs. NCBI nr
Match: KAA0046767.1 (26S protease regulatory subunit 8-like protein B-like [Cucumis melo var. makuwa]) HSP 1 Score: 102 bits (253), Expect = 1.92e-26 Identity = 51/55 (92.73%), Postives = 52/55 (94.55%), Query Frame = 0
BLAST of IVF0010604.2 vs. NCBI nr
Match: KAA0051596.1 (thioredoxin F-type [Cucumis melo var. makuwa] >TYK30543.1 thioredoxin F-type [Cucumis melo var. makuwa]) HSP 1 Score: 102 bits (254), Expect = 3.24e-25 Identity = 50/55 (90.91%), Postives = 53/55 (96.36%), Query Frame = 0
BLAST of IVF0010604.2 vs. NCBI nr
Match: KAB2046937.1 (hypothetical protein ES319_A13G011500v1 [Gossypium barbadense] >KAB2094464.1 hypothetical protein ES319_A02G160400v1 [Gossypium barbadense] >KAG4211493.1 hypothetical protein ERO13_A02G109502v2 [Gossypium hirsutum] >TYH38631.1 hypothetical protein ES332_D12G122900v1 [Gossypium tomentosum] >TYJ50053.1 hypothetical protein E1A91_A01G179300v1 [Gossypium mustelinum]) HSP 1 Score: 97.8 bits (242), Expect = 4.43e-25 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. NCBI nr
Match: TYH63822.1 (hypothetical protein ES332_D07G221800v1 [Gossypium tomentosum]) HSP 1 Score: 97.8 bits (242), Expect = 5.08e-25 Identity = 49/59 (83.05%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. TAIR 10
Match: AT5G19990.1 (regulatory particle triple-A ATPase 6A ) HSP 1 Score: 100.5 bits (249), Expect = 4.8e-22 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. TAIR 10
Match: AT5G20000.1 (AAA-type ATPase family protein ) HSP 1 Score: 100.5 bits (249), Expect = 4.8e-22 Identity = 50/59 (84.75%), Postives = 54/59 (91.53%), Query Frame = 0
BLAST of IVF0010604.2 vs. TAIR 10
Match: AT4G29040.1 (regulatory particle AAA-ATPase 2A ) HSP 1 Score: 52.0 bits (123), Expect = 1.9e-07 Identity = 27/54 (50.00%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of IVF0010604.2 vs. TAIR 10
Match: AT2G20140.1 (AAA-type ATPase family protein ) HSP 1 Score: 51.6 bits (122), Expect = 2.5e-07 Identity = 27/54 (50.00%), Postives = 36/54 (66.67%), Query Frame = 0
BLAST of IVF0010604.2 vs. TAIR 10
Match: AT1G53750.1 (regulatory particle triple-A 1A ) HSP 1 Score: 47.0 bits (110), Expect = 6.3e-06 Identity = 23/57 (40.35%), Postives = 37/57 (64.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|