IVF0008609.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTGCTTTTTTATTACGATCAAAAGGGCTTACTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGCTTTTTTATTACGATCAAAAGGGCTTACTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGCTTTTTTATTACGATCAAAAGGGCTTACTCCGGAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGAATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA MCAFLLRSKGLTPEIPEDLYHLIKKAVSIRKHLERNRKDKDSKFRLILVDS Homology
BLAST of IVF0008609.1 vs. ExPASy Swiss-Prot
Match: P62302 (40S ribosomal protein S13 OS=Glycine max OX=3847 GN=RPS13 PE=2 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 1.1e-16 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy Swiss-Prot
Match: P62299 (40S ribosomal protein S13 OS=Brugia pahangi OX=6280 GN=RPS13 PE=2 SV=2) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-16 Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy Swiss-Prot
Match: P62300 (40S ribosomal protein S13 OS=Wuchereria bancrofti OX=6293 GN=RPS13 PE=3 SV=2) HSP 1 Score: 85.5 bits (210), Expect = 1.9e-16 Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy Swiss-Prot
Match: P59223 (40S ribosomal protein S13-1 OS=Arabidopsis thaliana OX=3702 GN=RPS13A PE=2 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 2.5e-16 Identity = 40/47 (85.11%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy Swiss-Prot
Match: P59224 (40S ribosomal protein S13-2 OS=Arabidopsis thaliana OX=3702 GN=RPS13B PE=2 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 2.5e-16 Identity = 40/47 (85.11%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy TrEMBL
Match: A0A5A7V1J4 (40S ribosomal protein S13-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold518G00910 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 3.7e-15 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy TrEMBL
Match: A8UAD8 (40S ribosomal protein S13 OS=Barentsia elongata OX=478378 PE=2 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 8.3e-15 Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy TrEMBL
Match: A0A151TJI5 (40S ribosomal protein S13 OS=Cajanus cajan OX=3821 GN=KK1_013525 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.1e-14 Identity = 42/47 (89.36%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy TrEMBL
Match: A0A5A7UDU2 (40S ribosomal protein S13-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold60G003190 PE=3 SV=1) HSP 1 Score: 88.2 bits (217), Expect = 1.1e-14 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. ExPASy TrEMBL
Match: A0A0N4V0I2 (40S ribosomal protein S13 OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS3134 PE=3 SV=1) HSP 1 Score: 87.8 bits (216), Expect = 1.4e-14 Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. NCBI nr
Match: KAA0059571.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 88.6 bits (218), Expect = 1.97e-21 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0008609.1 vs. NCBI nr
Match: KAA0051875.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 87.0 bits (214), Expect = 8.03e-21 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. NCBI nr
Match: KAA0049888.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 1.14e-20 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. NCBI nr
Match: TYK07625.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK14810.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK15131.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK22659.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 1.14e-20 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. NCBI nr
Match: KAA0046917.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 86.7 bits (213), Expect = 1.14e-20 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. TAIR 10
Match: AT3G60770.1 (Ribosomal protein S13/S15 ) HSP 1 Score: 85.1 bits (209), Expect = 1.8e-17 Identity = 40/47 (85.11%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0008609.1 vs. TAIR 10
Match: AT4G00100.1 (ribosomal protein S13A ) HSP 1 Score: 85.1 bits (209), Expect = 1.8e-17 Identity = 40/47 (85.11%), Postives = 45/47 (95.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|