![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0001493.1 (mRNA) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAAAGAACCTCACGCCTCGACCTCGTCTGCAACCTCACGCTGTCGTCCGTCCTTCCACCATCAGATTGTCGAACTCCACCCTCAACCTCATCTGCAAATGCTGCCAACCATCTTTAAATGTCATCCGTCACCGGCAATCGTCGTCCATCGTTCGTCTCTGGAACTACTCGCCTACCATCGGCGACATTTCGTCAGGTTAGGCGTGGCAAAAAAACAAGATTTAGGACAAGAAAAATGGTAGCATTTGATATTCTTTTAGAATCCATCTCTGTCCGAGAAATGAAGAATTTTATATTTGTTTTTCAAACCGTTTTGGTATGTTTGTTTTCTTCTGATGATTCTCTTTAATCATCATCGATTCGTAGGGTTTTGTTTTTCATCTTCTTCTTGCTCTTTCAACCACTCCTATTTTGTTTTCTCCTTTCAGATCTCTATAAGAATCCCGTTGATGGATTCTCCGCTGGTCTAGTGGATGAGAGCAATATATTTGAATGGAGCATTAAAATTATTGGTCCTCCTGATACACTTTAG ATGCAAAAGAACCTCACGCCTCGACCTCGTCTGCAACCTCACGCTGTCGTCCGTCCTTCCACCATCAGATTGTCGAACTCCACCCTCAACCTCATCTGCAAATGCTGCCAACCATCTTTAAATGTCATCCGTCACCGGCAATCGTCGTCCATCGTTCGTCTCTGGAACTACTCGCCTACCATCGGCGACATTTCGTCAGATCTCTATAAGAATCCCGTTGATGGATTCTCCGCTGGTCTAGTGGATGAGAGCAATATATTTGAATGGAGCATTAAAATTATTGGTCCTCCTGATACACTTTAG ATGCAAAAGAACCTCACGCCTCGACCTCGTCTGCAACCTCACGCTGTCGTCCGTCCTTCCACCATCAGATTGTCGAACTCCACCCTCAACCTCATCTGCAAATGCTGCCAACCATCTTTAAATGTCATCCGTCACCGGCAATCGTCGTCCATCGTTCGTCTCTGGAACTACTCGCCTACCATCGGCGACATTTCGTCAGATCTCTATAAGAATCCCGTTGATGGATTCTCCGCTGGTCTAGTGGATGAGAGCAATATATTTGAATGGAGCATTAAAATTATTGGTCCTCCTGATACACTTTAG MQKNLTPRPRLQPHAVVRPSTIRLSNSTLNLICKCCQPSLNVIRHRQSSSIVRLWNYSPTIGDISSDLYKNPVDGFSAGLVDESNIFEWSIKIIGPPDTL Homology
BLAST of IVF0001493.1 vs. ExPASy Swiss-Prot
Match: Q42541 (Ubiquitin-conjugating enzyme E2 13 OS=Arabidopsis thaliana OX=3702 GN=UBC13 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy Swiss-Prot
Match: Q42540 (Ubiquitin-conjugating enzyme E2 7 OS=Arabidopsis thaliana OX=3702 GN=UBC7 PE=1 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.8e-10 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy Swiss-Prot
Match: P42747 (Ubiquitin-conjugating enzyme E2 14 OS=Arabidopsis thaliana OX=3702 GN=UBC14 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.2e-09 Identity = 26/34 (76.47%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy Swiss-Prot
Match: P62253 (Ubiquitin-conjugating enzyme E2 G1 OS=Homo sapiens OX=9606 GN=UBE2G1 PE=1 SV=3) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 21/35 (60.00%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy Swiss-Prot
Match: Q4R5Y8 (Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis OX=9541 GN=UBE2G1 PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.4e-07 Identity = 21/35 (60.00%), Postives = 31/35 (88.57%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy TrEMBL
Match: A0A5A7VL72 (Ubiquitin-conjugating enzyme E2 7 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold392G00500 PE=4 SV=1) HSP 1 Score: 208.8 bits (530), Expect = 1.1e-50 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy TrEMBL
Match: A0A5B6YT16 (Putative ubiquitin-conjugating enzyme E2 7 isoform X1 (Fragment) OS=Davidia involucrata OX=16924 GN=Din_003774 PE=3 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.2e-09 Identity = 31/34 (91.18%), Postives = 33/34 (97.06%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy TrEMBL
Match: A0A6N2LQ42 (Uncharacterized protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS265050 PE=3 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 2.1e-09 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy TrEMBL
Match: A0A426ZEJ2 (UBC core domain-containing protein OS=Ensete ventricosum OX=4639 GN=B296_00033620 PE=4 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 2.7e-09 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 0
BLAST of IVF0001493.1 vs. ExPASy TrEMBL
Match: A0A6A2ZAW7 (Ubiquitin-conjugating enzyme E2 7 OS=Hibiscus syriacus OX=106335 GN=F3Y22_tig00110954pilonHSYRG00190 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 4.6e-09 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of IVF0001493.1 vs. NCBI nr
Match: KAA0068164.1 (ubiquitin-conjugating enzyme E2 7 [Cucumis melo var. makuwa] >TYK21084.1 ubiquitin-conjugating enzyme E2 7 [Cucumis melo var. makuwa]) HSP 1 Score: 206 bits (525), Expect = 3.66e-67 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0001493.1 vs. NCBI nr
Match: RWW39308.1 (hypothetical protein BHE74_00055370, partial [Ensete ventricosum] >RZS13234.1 hypothetical protein BHM03_00044781, partial [Ensete ventricosum]) HSP 1 Score: 70.5 bits (171), Expect = 1.45e-13 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 0
BLAST of IVF0001493.1 vs. NCBI nr
Match: TYK21942.1 (Ubiquitin-conjugating enzyme E2 7 [Cucumis melo var. makuwa]) HSP 1 Score: 69.3 bits (168), Expect = 2.31e-13 Identity = 31/34 (91.18%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of IVF0001493.1 vs. NCBI nr
Match: RRT62407.1 (hypothetical protein B296_00033620 [Ensete ventricosum]) HSP 1 Score: 70.5 bits (171), Expect = 2.56e-13 Identity = 30/37 (81.08%), Postives = 34/37 (91.89%), Query Frame = 0
BLAST of IVF0001493.1 vs. NCBI nr
Match: KAF7823595.1 (ubiquitin-conjugating enzyme E2 7 [Senna tora]) HSP 1 Score: 68.2 bits (165), Expect = 6.58e-13 Identity = 30/34 (88.24%), Postives = 32/34 (94.12%), Query Frame = 0
BLAST of IVF0001493.1 vs. TAIR 10
Match: AT3G46460.1 (ubiquitin-conjugating enzyme 13 ) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-11 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of IVF0001493.1 vs. TAIR 10
Match: AT5G59300.1 (ubiquitin carrier protein 7 ) HSP 1 Score: 66.6 bits (161), Expect = 1.3e-11 Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 0
BLAST of IVF0001493.1 vs. TAIR 10
Match: AT3G55380.1 (ubiquitin-conjugating enzyme 14 ) HSP 1 Score: 63.9 bits (154), Expect = 8.2e-11 Identity = 26/34 (76.47%), Postives = 30/34 (88.24%), Query Frame = 0
BLAST of IVF0001493.1 vs. TAIR 10
Match: AT3G55380.2 (ubiquitin-conjugating enzyme 14 ) HSP 1 Score: 63.9 bits (154), Expect = 8.2e-11 Identity = 26/34 (76.47%), Postives = 30/34 (88.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|