HG10019832.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1

Overview


Name	HG10019832.1
Type	mRNA
Organism	Lagenaria siceraria cv. Hangzhou Gourd (Bottle gourd (Hangzhou Gourd) v1)
Description	Unknown protein
Location	Chr04: 25910983 .. 25911165 (-)
Sequence length	183
RNA-Seq Expression	HG10019832.1
Synteny	HG10019832.1

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGGCAGTGTTAGGGATCCGACGAGAAGAAGAGAAAGCCAAGAACAACAAAACAACCAATATCATAACCGGCAAACCGAGAACCGCCAACGGCGGCGGAGGAAGCGGCGGCACCACCAGAGGCAACAGAAGCAAAGAAGCTGTCCACACAAGTAAAACCATCACTGAACTTAGGCTGCAATAA

mRNA sequence

ATGGCAGTGTTAGGGATCCGACGAGAAGAAGAGAAAGCCAAGAACAACAAAACAACCAATATCATAACCGGCAAACCGAGAACCGCCAACGGCGGCGGAGGAAGCGGCGGCACCACCAGAGGCAACAGAAGCAAAGAAGCTGTCCACACAAGTAAAACCATCACTGAACTTAGGCTGCAATAA

Coding sequence (CDS)

ATGGCAGTGTTAGGGATCCGACGAGAAGAAGAGAAAGCCAAGAACAACAAAACAACCAATATCATAACCGGCAAACCGAGAACCGCCAACGGCGGCGGAGGAAGCGGCGGCACCACCAGAGGCAACAGAAGCAAAGAAGCTGTCCACACAAGTAAAACCATCACTGAACTTAGGCTGCAATAA

Protein sequence

MAVLGIRREEEKAKNNKTTNIITGKPRTANGGGGSGGTTRGNRSKEAVHTSKTITELRLQ

Homology

The following BLAST results are available for this feature:

BLAST of HG10019832.1 vs.


Match Name	E-value	Identity	Description

BLAST of HG10019832.1 vs.


Match Name	E-value	Identity	Description

BLAST of HG10019832.1 vs.


Match Name	E-value	Identity	Description

BLAST of HG10019832.1 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 17..44
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..60
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..16

Relationships

This mRNA is a part of the following gene feature(s):


Feature Name	Unique Name	Type
HG10019832	HG10019832	gene

The following CDS feature(s) are a part of this mRNA:


Feature Name	Unique Name	Type
HG10019832.1-cds	HG10019832.1-cds-Chr04:25910983..25911165	CDS

The following polypeptide feature(s) derives from this mRNA:


Feature Name	Unique Name	Type
HG10019832.1	HG10019832.1-protein	polypeptide