![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
HG10018364.1 (mRNA) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGGTGAATCGACTTTGTTCAAGTTCTTGAGCCCAGGACGCCGTTTCCAATCTACGGACATCAAAGCCGCCGCCGGCTGGGGTGTCGCCGCCGCCACAACTGCTCTGTGGGTCGTTCAGGTTTTCTCCTTTCCTAAACTCATCGATCTATACTATTATTTCTGGTTTTCGGGGATTTATACAGTGAATCTTTTGACTCTCCATGTTAGATTAAAAGATGCGTCGATCTTCTTGAAAGTTGATTCTTGA ATGGCAGGTGAATCGACTTTGTTCAAGTTCTTGAGCCCAGGACGCCGTTTCCAATCTACGGACATCAAAGCCGCCGCCGGCTGGGGTGTCGCCGCCGCCACAACTGCTCTGTGGGTCGTTCAGGTTTTCTCCTTTCCTAAACTCATCGATCTATACTATTATTTCTGGTTTTCGGGGATTTATACAGTGAATCTTTTGACTCTCCATGTTAGATTAAAAGATGCGTCGATCTTCTTGAAAGTTGATTCTTGA ATGGCAGGTGAATCGACTTTGTTCAAGTTCTTGAGCCCAGGACGCCGTTTCCAATCTACGGACATCAAAGCCGCCGCCGGCTGGGGTGTCGCCGCCGCCACAACTGCTCTGTGGGTCGTTCAGGTTTTCTCCTTTCCTAAACTCATCGATCTATACTATTATTTCTGGTTTTCGGGGATTTATACAGTGAATCTTTTGACTCTCCATGTTAGATTAAAAGATGCGTCGATCTTCTTGAAAGTTGATTCTTGA MAGESTLFKFLSPGRRFQSTDIKAAAGWGVAAATTALWVVQVFSFPKLIDLYYYFWFSGIYTVNLLTLHVRLKDASIFLKVDS Homology
BLAST of HG10018364.1 vs. NCBI nr
Match: KGN45840.1 (hypothetical protein Csa_005761 [Cucumis sativus]) HSP 1 Score: 92.4 bits (228), Expect = 1.9e-15 Identity = 44/51 (86.27%), Postives = 48/51 (94.12%), Query Frame = 0
BLAST of HG10018364.1 vs. NCBI nr
Match: KAG6578485.1 (hypothetical protein SDJN03_22933, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 86.3 bits (212), Expect = 1.4e-13 Identity = 42/47 (89.36%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of HG10018364.1 vs. NCBI nr
Match: KAG7016049.1 (hypothetical protein SDJN02_21153 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 83.6 bits (205), Expect = 9.0e-13 Identity = 40/41 (97.56%), Postives = 41/41 (100.00%), Query Frame = 0
BLAST of HG10018364.1 vs. NCBI nr
Match: KAA0051979.1 (Ubiquinol-cytochrome c reductase complex 6.7 kDa [Cucumis melo var. makuwa] >TYK04578.1 Ubiquinol-cytochrome c reductase complex 6.7 kDa [Cucumis melo var. makuwa]) HSP 1 Score: 82.8 bits (203), Expect = 1.5e-12 Identity = 47/83 (56.63%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of HG10018364.1 vs. NCBI nr
Match: KAF9661439.1 (hypothetical protein SADUNF_Sadunf19G0068800 [Salix dunnii]) HSP 1 Score: 68.9 bits (167), Expect = 2.3e-08 Identity = 32/47 (68.09%), Postives = 39/47 (82.98%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy Swiss-Prot
Match: P48505 (Ubiquinol-cytochrome c reductase complex 6.7 kDa protein OS=Solanum tuberosum OX=4113 PE=1 SV=2) HSP 1 Score: 57.8 bits (138), Expect = 6.9e-08 Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy Swiss-Prot
Match: Q94K78 (Cytochrome b-c1 complex subunit 10, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCRY PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 2.5e-05 Identity = 25/47 (53.19%), Postives = 32/47 (68.09%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy TrEMBL
Match: A0A0A0K7V0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G014600 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 9.3e-16 Identity = 44/51 (86.27%), Postives = 48/51 (94.12%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy TrEMBL
Match: A0A5D3BZX3 (Ubiquinol-cytochrome c reductase complex 6.7 kDa OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold409G002150 PE=4 SV=1) HSP 1 Score: 82.8 bits (203), Expect = 7.4e-13 Identity = 47/83 (56.63%), Postives = 51/83 (61.45%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy TrEMBL
Match: A9PAG4 (Uncharacterized protein OS=Populus trichocarpa OX=3694 GN=POPTR_019G059500 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 5.5e-08 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy TrEMBL
Match: A0A2P2J2E2 (Uncharacterized protein OS=Rhizophora mucronata OX=61149 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 3.6e-07 Identity = 32/47 (68.09%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of HG10018364.1 vs. ExPASy TrEMBL
Match: A0A0D2SX41 (Uncharacterized protein OS=Gossypium raimondii OX=29730 GN=B456_010G219300 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 4.6e-07 Identity = 29/47 (61.70%), Postives = 35/47 (74.47%), Query Frame = 0
BLAST of HG10018364.1 vs. TAIR 10
Match: AT2G40765.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion, mitochondrial respiratory chain complex III; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; Has 32 Blast hits to 32 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 32; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 49.3 bits (116), Expect = 1.7e-06 Identity = 25/47 (53.19%), Postives = 32/47 (68.09%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
This mRNA is a part of the following gene feature(s):
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|