![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Cp4.1LG03g12470.1 (mRNA) Cucurbita pepo (MU‐CU‐16) v4.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGCTGTGGCTGTGGCTTTGGCATTGGTTTTGATAGCTATGATTGGTTTGGGTGAAGCTCAAACCGTATGCAACATGTCATTTCCTGATATATTTTCATGTAGTTCGTCGATGATGCCTCCGAACCCGACACCGCCTACCGCCCAGTGCTGCACGGCGCTCTCGCACGCCGACTTGAAATGCTTATGCGACTACCTAAAAGCTGGAGCCTTTTCTTATCTTGGCATTGACCCTAGTCTTGCCTTGCAGCTCCCTAACAAGTGCAACATTCCTAACCCACCAACTTGTTAG ATGAAGGCTGTGGCTGTGGCTTTGGCATTGGTTTTGATAGCTATGATTGGTTTGGGTGAAGCTCAAACCGTATGCAACATGTCATTTCCTGATATATTTTCATGTAGTTCGTCGATGATGCCTCCGAACCCGACACCGCCTACCGCCCAGTGCTGCACGGCGCTCTCGCACGCCGACTTGAAATGCTTATGCGACTACCTAAAAGCTGGAGCCTTTTCTTATCTTGGCATTGACCCTAGTCTTGCCTTGCAGCTCCCTAACAAGTGCAACATTCCTAACCCACCAACTTGTTAG ATGAAGGCTGTGGCTGTGGCTTTGGCATTGGTTTTGATAGCTATGATTGGTTTGGGTGAAGCTCAAACCGTATGCAACATGTCATTTCCTGATATATTTTCATGTAGTTCGTCGATGATGCCTCCGAACCCGACACCGCCTACCGCCCAGTGCTGCACGGCGCTCTCGCACGCCGACTTGAAATGCTTATGCGACTACCTAAAAGCTGGAGCCTTTTCTTATCTTGGCATTGACCCTAGTCTTGCCTTGCAGCTCCCTAACAAGTGCAACATTCCTAACCCACCAACTTGTTAG MKAVAVALALVLIAMIGLGEAQTVCNMSFPDIFSCSSSMMPPNPTPPTAQCCTALSHADLKCLCDYLKAGAFSYLGIDPSLALQLPNKCNIPNPPTC Homology
BLAST of Cp4.1LG03g12470.1 vs. ExPASy Swiss-Prot
Match: Q8W453 (Putative lipid-transfer protein DIR1 OS=Arabidopsis thaliana OX=3702 GN=DIR1 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.2e-13 Identity = 35/94 (37.23%), Postives = 52/94 (55.32%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. NCBI nr
Match: KAG6582086.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 176 bits (447), Expect = 2.34e-55 Identity = 86/97 (88.66%), Postives = 90/97 (92.78%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. NCBI nr
Match: KAG7018501.1 (putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 152 bits (385), Expect = 9.16e-45 Identity = 76/87 (87.36%), Postives = 80/87 (91.95%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. NCBI nr
Match: XP_038898435.1 (putative lipid-transfer protein DIR1 [Benincasa hispida]) HSP 1 Score: 126 bits (316), Expect = 2.34e-35 Identity = 58/92 (63.04%), Postives = 72/92 (78.26%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. NCBI nr
Match: XP_022979997.1 (putative lipid-transfer protein DIR1 [Cucurbita maxima]) HSP 1 Score: 124 bits (312), Expect = 9.53e-35 Identity = 57/93 (61.29%), Postives = 71/93 (76.34%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. NCBI nr
Match: XP_022955375.1 (putative lipid-transfer protein DIR1 [Cucurbita moschata] >XP_023526472.1 putative lipid-transfer protein DIR1 [Cucurbita pepo subsp. pepo] >KAG6582085.1 putative lipid-transfer protein DIR1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 124 bits (311), Expect = 1.35e-34 Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. ExPASy TrEMBL
Match: A0A6J1IQ87 (putative lipid-transfer protein DIR1 OS=Cucurbita maxima OX=3661 GN=LOC111479523 PE=4 SV=1) HSP 1 Score: 124 bits (312), Expect = 4.61e-35 Identity = 57/93 (61.29%), Postives = 71/93 (76.34%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. ExPASy TrEMBL
Match: A0A6J1GUZ3 (putative lipid-transfer protein DIR1 OS=Cucurbita moschata OX=3662 GN=LOC111457423 PE=4 SV=1) HSP 1 Score: 124 bits (311), Expect = 6.55e-35 Identity = 57/93 (61.29%), Postives = 72/93 (77.42%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. ExPASy TrEMBL
Match: A0A6J1CC99 (putative lipid-transfer protein DIR1 OS=Momordica charantia OX=3673 GN=LOC111009409 PE=4 SV=1) HSP 1 Score: 124 bits (310), Expect = 9.30e-35 Identity = 58/92 (63.04%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. ExPASy TrEMBL
Match: A0A0A0KZ41 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_4G017140 PE=4 SV=1) HSP 1 Score: 116 bits (291), Expect = 7.72e-32 Identity = 53/97 (54.64%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. ExPASy TrEMBL
Match: A0A0A1IXE5 (Lipid binding/ Lipid transporter protein OS=Cucumis sativus OX=3659 GN=LBP PE=2 SV=1) HSP 1 Score: 115 bits (287), Expect = 3.14e-31 Identity = 52/97 (53.61%), Postives = 70/97 (72.16%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. TAIR 10
Match: AT5G48485.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-14 Identity = 35/94 (37.23%), Postives = 52/94 (55.32%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. TAIR 10
Match: AT5G55460.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-06 Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. TAIR 10
Match: AT3G52130.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 48.9 bits (115), Expect = 2.7e-06 Identity = 26/64 (40.62%), Postives = 36/64 (56.25%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. TAIR 10
Match: AT3G53980.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 40.4 bits (93), Expect = 9.5e-04 Identity = 32/104 (30.77%), Postives = 47/104 (45.19%), Query Frame = 0
BLAST of Cp4.1LG03g12470.1 vs. TAIR 10
Match: AT3G53980.2 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 40.4 bits (93), Expect = 9.5e-04 Identity = 32/104 (30.77%), Postives = 47/104 (45.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucurbita pepo (Zucchini) v1
Date Performed: 2021-10-25
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|