Cmc07g0186681.1 (mRNA) Melon (Charmono) v1.1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAAGATCGGATGATTTGTCACTTTCTAAATCTTATTCTTTCTCAACAATATCTCTGTCTTATGGAGCTTTATAATGAAACCAAAGATACTGATATCTTGGTAGCATTCCAAGTAACTCCTCAATCAGAAGTTCCACCGCTTCGTGGGGAAGCAGGGATCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGAGATTACCAGTCTTGATCGTTGA ATGCAAGATCGGATGATTTGTCACTTTCTAAATCTTATTCTTTCTCAACAATATCTCTGTCTTATGGAGCTTTATAATGAAACCAAAGATACTGATATCTTGGTAGCATTCCAAGTAACTCCTCAATCAGAAGTTCCACCGCTTCGTGGGGAAGCAGGGATCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGAGATTACCAGTCTTGATCGTTGA ATGCAAGATCGGATGATTTGTCACTTTCTAAATCTTATTCTTTCTCAACAATATCTCTGTCTTATGGAGCTTTATAATGAAACCAAAGATACTGATATCTTGGTAGCATTCCAAGTAACTCCTCAATCAGAAGTTCCACCGCTTCGTGGGGAAGCAGGGATCGCTGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTGTGGACCGATGAGATTACCAGTCTTGATCGTTGA MQDRMICHFLNLILSQQYLCLMELYNETKDTDILVAFQVTPQSEVPPLRGEAGIAVAAESSTGTWTTVWTDEITSLDR Homology
BLAST of Cmc07g0186681.1 vs. NCBI nr
Match: AIG54729.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Dillenia grandifolia]) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-13 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. NCBI nr
Match: AUR28390.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Goodyera oblongifolia]) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. NCBI nr
Match: QCX35970.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Aerides rosea]) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. NCBI nr
Match: QCX35971.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Aerides rosea]) HSP 1 Score: 84.0 bits (206), Expect = 6.4e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. NCBI nr
Match: AYE20222.1 (ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit, partial [Orobanche sp. ARIZ 344844]) HSP 1 Score: 83.6 bits (205), Expect = 8.4e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy Swiss-Prot
Match: P92401 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Lupinus microcarpus var. densiflorus OX=61113 GN=rbcL PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 3.2e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy Swiss-Prot
Match: P92406 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Lupinus microcarpus OX=53231 GN=rbcL PE=3 SV=1) HSP 1 Score: 82.0 bits (201), Expect = 3.2e-15 Identity = 42/53 (79.25%), Postives = 45/53 (84.91%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy Swiss-Prot
Match: P28389 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Casuarina equisetifolia OX=3523 GN=rbcL PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.5e-15 Identity = 42/52 (80.77%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy Swiss-Prot
Match: A9LYA9 (Ribulose bisphosphate carboxylase large chain OS=Acorus americanus OX=263995 GN=rbcL PE=3 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 7.2e-15 Identity = 42/52 (80.77%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy Swiss-Prot
Match: Q3V526 (Ribulose bisphosphate carboxylase large chain OS=Acorus calamus OX=4465 GN=rbcL PE=3 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 7.2e-15 Identity = 42/52 (80.77%), Postives = 44/52 (84.62%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy TrEMBL
Match: A0A0D3MEQ6 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Dillenia grandifolia OX=1504417 GN=rbcL PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 3.1e-13 Identity = 42/52 (80.77%), Postives = 46/52 (88.46%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy TrEMBL
Match: A0A4Y5QMG0 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Aerides rosea OX=339046 GN=rbcL PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 3.1e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy TrEMBL
Match: A0A4Y5QME9 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Aerides rosea OX=339046 GN=rbcL PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 3.1e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy TrEMBL
Match: A0A3G1MV98 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Goodyera oblongifolia OX=798534 GN=rbcL PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 3.1e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. ExPASy TrEMBL
Match: A0A386NCH1 (Ribulose bisphosphate carboxylase large chain (Fragment) OS=Orobanche sp. ARIZ 344844 OX=1873173 GN=rbcL PE=3 SV=1) HSP 1 Score: 83.6 bits (205), Expect = 4.1e-13 Identity = 43/52 (82.69%), Postives = 45/52 (86.54%), Query Frame = 0
BLAST of Cmc07g0186681.1 vs. TAIR 10
Match: ATCG00490.1 (ribulose-bisphosphate carboxylases ) HSP 1 Score: 80.9 bits (198), Expect = 5.1e-16 Identity = 42/52 (80.77%), Postives = 44/52 (84.62%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (Charmono) v1.1
Date Performed: 2022-10-13
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|