![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Bhi04M001879 (mRNA) Wax gourd (B227) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.GCAAAGGCGGCCCCGACAACAACAAATTCCGTTACCGCGGCGTCCGTCAACGCAGCTGGGGCAAATAAGGGTCGCCGAGATTCGCGAGCCTCGTAAACGCACCCGCAAGTGGTCGGTACTTTCTCCACCTGAAGACGCCGCTCGTGCTTACGACCGAGCCGCCATCATCCTTTACGGCTCCCGCGCCAACTCAACCTTCAATCCACTTCCCCAACTCTTCCTCTAA GCAAAGGCGGCCCCGACAACAACAAATTCCGTTACCGCGGCGTCCGTCAACGCAGCTGGGGCAAATAAGGGTCGCCGAGATTCGCGAGCCTCGTAAACGCACCCGCAAGTGGTCGGTACTTTCTCCACCTGAAGACGCCGCTCGTGCTTACGACCGAGCCGCCATCATCCTTTACGGCTCCCGCGCCAACTCAACCTTCAATCCACTTCCCCAACTCTTCCTCTAA GCAAAGGCGGCCCCGACAACAACAAATTCCGTTACCGCGGCGTCCGTCAACGCAGCTGGGGCAAATAAGGGTCGCCGAGATTCGCGAGCCTCGTAAACGCACCCGCAAGTGGTCGGTACTTTCTCCACCTGAAGACGCCGCTCGTGCTTACGACCGAGCCGCCATCATCCTTTACGGCTCCCGCGCCAACTCAACCTTCAATCCACTTCCCCAACTCTTCCTCTAA QRRPRQQQIPLPRRPSTQLGQIRVAEIREPRKRTRKWSVLSPPEDAARAYDRAAIILYGSRANSTFNPLPQLFL Homology
BLAST of Bhi04M001879 vs. TAIR 10
Match: AT2G40220.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 63.2 bits (152), Expect = 1.0e-10 Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = 0
BLAST of Bhi04M001879 vs. TAIR 10
Match: AT4G34410.1 (redox responsive transcription factor 1 ) HSP 1 Score: 44.3 bits (103), Expect = 5.0e-05 Identity = 24/43 (55.81%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of Bhi04M001879 vs. TAIR 10
Match: AT4G16750.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 43.9 bits (102), Expect = 6.5e-05 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of Bhi04M001879 vs. TAIR 10
Match: AT1G77200.1 (Integrase-type DNA-binding superfamily protein ) HSP 1 Score: 43.5 bits (101), Expect = 8.5e-05 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of Bhi04M001879 vs. TAIR 10
Match: AT5G44210.1 (erf domain protein 9 ) HSP 1 Score: 43.5 bits (101), Expect = 8.5e-05 Identity = 25/47 (53.19%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy Swiss-Prot
Match: A0MES8 (Ethylene-responsive transcription factor ABI4 OS=Arabidopsis thaliana OX=3702 GN=ABI4 PE=1 SV=2) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-09 Identity = 32/46 (69.57%), Postives = 34/46 (73.91%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy Swiss-Prot
Match: C7J2Z1 (Ethylene-responsive transcription factor ABI4 OS=Oryza sativa subsp. japonica OX=39947 GN=ABI4 PE=3 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.3e-09 Identity = 31/50 (62.00%), Postives = 36/50 (72.00%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy Swiss-Prot
Match: Q9SXS8 (Ethylene-responsive transcription factor 3 OS=Nicotiana tabacum OX=4097 GN=ERF3 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 4.1e-04 Identity = 26/47 (55.32%), Postives = 30/47 (63.83%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy Swiss-Prot
Match: Q9SZ06 (Ethylene-responsive transcription factor ERF109 OS=Arabidopsis thaliana OX=3702 GN=ERF109 PE=1 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 7.0e-04 Identity = 24/43 (55.81%), Postives = 27/43 (62.79%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy Swiss-Prot
Match: Q9SUK8 (Ethylene-responsive transcription factor ERF039 OS=Arabidopsis thaliana OX=3702 GN=ERF039 PE=2 SV=1) HSP 1 Score: 43.9 bits (102), Expect = 9.2e-04 Identity = 24/47 (51.06%), Postives = 31/47 (65.96%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy TrEMBL
Match: A0A067L8M8 (AP2/ERF domain-containing protein OS=Jatropha curcas OX=180498 GN=JCGZ_01232 PE=4 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 3.7e-08 Identity = 35/47 (74.47%), Postives = 36/47 (76.60%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy TrEMBL
Match: A0A6A5LV09 (Putative transcription factor AP2-EREBP family OS=Lupinus albus OX=3870 GN=Lal_00021922 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 4.9e-08 Identity = 35/46 (76.09%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy TrEMBL
Match: A0A498JM37 (AP2/ERF domain-containing protein OS=Malus domestica OX=3750 GN=DVH24_024356 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 4.9e-08 Identity = 35/46 (76.09%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy TrEMBL
Match: A0A2C9V286 (AP2/ERF domain-containing protein OS=Manihot esculenta OX=3983 GN=MANES_10G010300 PE=4 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 4.9e-08 Identity = 35/46 (76.09%), Postives = 35/46 (76.09%), Query Frame = 0
BLAST of Bhi04M001879 vs. ExPASy TrEMBL
Match: A0A1U8AFY6 (ethylene-responsive transcription factor ABI4 OS=Nelumbo nucifera OX=4432 GN=LOC104599845 PE=4 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 6.4e-08 Identity = 33/48 (68.75%), Postives = 36/48 (75.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Wax gourd (B227) v1
Date Performed: 2021-10-22
Relationships
This mRNA is a part of the following gene feature(s):
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
GO Annotation
GO Assignments
This mRNA is annotated with the following GO terms.
|